SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7244.FBpp0226449 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  7244.FBpp0226449
Domain Number - Region: 178-247
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.00209
Family PspA lactotransferrin-binding region 0.01
Further Details:      
 
Domain Number - Region: 9-111
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00489
Family Calponin-homology domain, CH-domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7244.FBpp0226449
Sequence length 259
Comment (Drosophila virilis)
Sequence
MLNSRNLSAEEHKELDDWLNTKEISLNHRTRRDLSDVVNMALLFKNVDAKLVNMKNYTSH
GKLALKLLNWETFNLKVLRKTGLILMRPALEQLASGDLNAIRSLLFILMRIERDGIQLSS
RRASPTKGQRQQSDNRDDAQEEVRSQTLIPTEPSIPNQIQTQNQSPTQNETETSALLSHN
LRVTYANYEELKRINEKKEQYIGSLSQKVQYLEKVILEKEKRINELVDHLSTLSVRIISM
QTSLTDDELPQPQPQTQPE
Download sequence
Identical sequences 7244.FBpp0226449 FBpp0226449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]