SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7244.FBpp0230324 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7244.FBpp0230324
Domain Number 1 Region: 14-135
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.12e-24
Family Calponin-homology domain, CH-domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7244.FBpp0230324
Sequence length 1080
Comment (Drosophila virilis)
Sequence
MALTQKPGSKQYVKNVLVMKKDTCSVRELLNWVNAEMQCDVRELSELKTGGVYCQFVHKL
FPAEISLTKVYLYTNTSYEIEANFKLLRNTFAKLNIRKDVPNRELAKGRGHYEFLNWLHK
FHKMNHNGRAYDASKERCGKPIGLKKIVEVERRFDYAAYLRRSSTIIASVHPRKPVELVP
RAHSLLGISVKPDNLASWKLNPTPDKSKAKAKGSTQSILGRKSAQPAGKSVKPICKTANP
CNEPGESVQSQPDQSDESRQSTPESLPSVPLKQGYPKRVQSPAQETDPESDVESPNPEPH
PAVPSKRQSYKRSHSAAKRLPPKPIQAVQETLHSTSERISAVPSKRASYKRNQLPAQEIP
LEPLDAWFEPVESPLKRVNYRRAQSPDKSMSPEPIEPEPEQSRSTTDLANPESTLEPHSS
LTPVPARRVNYKRVQSPAKTVAPEPPVAGHAPGGEIPPKPQPVLLKRVKHKSSRSATREK
HPVSLQAWFEPLETIPKQLSSAHLKGVNRNRETAPISTQAQRSESVPAPTSKRVNYKRVQ
SPAKTVLSQTPEARYEPARQIEPESRCEPVSTPDPHPMFVPLKRVKDKRIQPAGKVAQKT
SQTDQETLQSESEPLSTVPARRTVPESQTVHDPLQTEPEPLSGLPSRRLNSKRTQEVAPK
TSKASYELRQSEWVAASVEKSVKPICELAKLSTEPVEESTLEPLKRIIYKRIQSPGRSIV
PEPCEPCRKPVEPTPKAISAATSKRAIVKRTQSPAKTVSAELPQAGHERESTPEPQATTT
QPPQRVNSKPISTASRVIGAKSCEAGLEPLQVERNPLPDPPIPSTTREIALKSLQADFES
LPDPLSLRANIKPIHEVAEELLQANDAQPQWKAEPLPNPTEQRLSNKPDPPTFSELGRKS
NHETLRSEQEPLPDPPSERVGNKSIPSTSRNNAPELSEADQEPIHSEPEPPFADPPSERA
GNNPNPPKSREIAAESLQADEEPLPSKPDLSAVLKVGQSVVRAYYEESDCVALPSDSDSE
DEKDDHIWDVRRQIVLLRDKLTTIETILLKYSASSRQSVKKLKRYLRKQQVDEPFVLGSF
Download sequence
Identical sequences B4MAG4
XP_002058115.1.90633 FBpp0230324 7244.FBpp0230324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]