SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7244.FBpp0230807 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7244.FBpp0230807
Domain Number 1 Region: 20-253
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.53e-87
Family Calponin-homology domain, CH-domain 0.0000216
Further Details:      
 
Domain Number 2 Region: 269-392
Classification Level Classification E-value
Superfamily Spectrin repeat 6.67e-33
Family Spectrin repeat 0.00000251
Further Details:      
 
Domain Number 3 Region: 506-626
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-26
Family Spectrin repeat 0.0000147
Further Details:      
 
Domain Number 4 Region: 393-502
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-23
Family Spectrin repeat 0.00000597
Further Details:      
 
Domain Number 5 Region: 630-742
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-21
Family Spectrin repeat 0.0000145
Further Details:      
 
Domain Number 6 Region: 735-869
Classification Level Classification E-value
Superfamily EF-hand 1.46e-20
Family EF-hand modules in multidomain proteins 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7244.FBpp0230807
Sequence length 895
Comment (Drosophila virilis)
Sequence
MMMENGISMEYGDGYMEQEEEWEREGLLDPAWEKQQKKTFTAWCNSHLRKAGTAIDNIEE
DFRNGLKLMLLLEVISGETLPKPDRGKMRFHKIANVNKALDFIASKGVHLVSIGAEEIVD
GNLKMTLGMIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGL
AFCALIHRHRPDLIDYAKLSKDNPLENLNTAFDVAEKYLDIPRMLDPDDLINTPKPDERA
IMTYVSCYYHAFQGAQQAETAANRICKVLKVNQENERLMEEYERLASDLLEWIRRTMPWL
NSRQADNSLAGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAYLPTE
GKTVSDISNAWKGLELAEKAFEEWLLAETMRLERLEHLAQKFKHKADAHEDWTRGKEEML
QSQDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNTLEYHDCVSVNARCQ
RICDQWDRLGALTQRRRTALDEAERILEKIDILHLEFAKRAAPFNNWLDGTREDLVDMFI
VHTMEEIQGLIQAHDQFKATLGEADKEFNLIVNLVREVESIVKQHQIPGGLENPYTTLTA
NDMTRKWTDVRQLVPQRDQTLANELRKQQNNEMLRRQFAEKANVVGPWIERQMDAVTAIG
MGLQGSLEDQLHRLKEYEQAVYAYKPNIEELEKIHQAVQESMIFENRYTNYTMETLRVGW
EQLLTSINRNINEVENQILTRDSKGISQEQLNEFRSSFNHFDKNRTGRLTPEEFKSCLVS
LGYSIGKDRQGDMDFQRILAVVDPNSTGYVHFDAFLDFMTRESTDTDTAEQVIDSFRILA
ADKPYILPDELRRELPPDQAEYCIQRMPPYKGPNGVPGALDYMSFSTALYGETDL
Download sequence
Identical sequences FBpp0230807 7244.FBpp0230807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]