SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7244.FBpp0232179 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7244.FBpp0232179
Domain Number 1 Region: 7-135
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.06e-35
Family Calponin-homology domain, CH-domain 0.0000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7244.FBpp0232179
Sequence length 191
Comment (Drosophila virilis)
Sequence
MALSQVINVISTNNTKPTWSRQAILTWCNKCLNSDIQKIEDLCTGAAYCCLLDILFPDSV
NLRKVKFISNQEIDYINNLIMLQQCFTKLKINKSIPIYKLVKGKFQDNYEFAIWFRLFYD
ANFTKMPDGYNATEKRNNQPLTKEQAQKIRRSRTATTLTPKLSVRRRSRTHEPTIEEPVL
AIARGANRPHI
Download sequence
Identical sequences B4LTB5
FBpp0232179 XP_002052802.1.90633 XP_015028540.1.90633 7244.FBpp0232179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]