SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7244.FBpp0232609 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7244.FBpp0232609
Domain Number 1 Region: 30-86
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000018
Family Antifungal peptide scarabaecin 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7244.FBpp0232609
Sequence length 90
Comment (Drosophila virilis)
Sequence
MKAAFVLLCLALFVAVAYGSDCDPDGNGQPTCSGTSSTRYRNNWDPTRYWVCQGNTATSV
LCEEQTGFDPKTSTCVSWSSWQWYPPCPSD
Download sequence
Identical sequences B4M8V6
FBpp0232609 7244.FBpp0232609 XP_002057559.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]