SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7244.FBpp0233414 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7244.FBpp0233414
Domain Number 1 Region: 228-427
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-49
Family DBL homology domain (DH-domain) 0.0000104
Further Details:      
 
Domain Number 2 Region: 30-166
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.06e-27
Family Calponin-homology domain, CH-domain 0.0023
Further Details:      
 
Domain Number 3 Region: 417-591
Classification Level Classification E-value
Superfamily PH domain-like 5.16e-24
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 
Domain Number 4 Region: 629-740
Classification Level Classification E-value
Superfamily SH2 domain 9.83e-20
Family SH2 domain 0.001
Further Details:      
 
Domain Number 5 Region: 735-803
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000958
Family SH3-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7244.FBpp0233414
Sequence length 806
Comment (Drosophila virilis)
Sequence
MSSNSFGSGAAAAAALTSASAAAAAAAAAAVNSDLWRECVAWLVRCKVIPADHKAALPDA
EIRILAMTLRDGVLLCNLVIHLDPSSMDAREFNRKPQMAQFLCCKNIKLFLDVCHNHFNI
RDADLFEPTMLYDLTNFHRVLITLSKLSQCRKVQQMHPELLGFNLQLSPSERSHSDEAIY
KDLHSTTTDNIACNGTVYDHTNTKEEEVYQDLCALHRTSRGQTTSATSFEQRDYVIRELI
DTESNYLDVLNALKSKFMLPLERHLNQDELRLIFPRIRELADIHTKFLEKLRESLVPSTK
LKMGQVFLEFREPFLIYGEYCSCLLNAIDYLADVCKKNQIIDQLVQKCEREYNVGKLQLR
DILSVPMQRILKYHLLLDKLVKETSPLHEDYRSLERAKDAMIDVSQYINEVKRDSDHLVI
IQKVKDSIFDLNLPQNGNDLLQYGRLLLDGDLHIKAHEDQKTKMRYAFVFDKILILVKPL
HIKTGDMQYTYRDSHNLADYRVEQSHSRRTLGRDTRFRYQLLLARKSAKTAFTLYLKSEH
ERDKWRKALTEAMESLDPPGCRNTDHKMEIYTFDAPTTCRHCSKFLKGRIHQGYRCKVCQ
ISVHRGCISSTGRCKQNPISIPPPVCDRQLSEFNWFVGNMDRETAANRLENRRIGTYLLR
VRPQGASSPHETMYALSLKTDDHVIKHMKINQENDGESMLYCLSSRRHFKTIVELVSYYE
RNDLGENFAGLNQSLQWPFREVIATALYDFDPKAGSNQLQLRTDCQVLVIGKDGDSKGWW
RGKIGDTVGYFPKEYVQEHPVTSDEL
Download sequence
Identical sequences B4M3A0
XP_002055074.1.90633 7244.FBpp0233414 FBpp0233414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]