SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7244.FBpp0233476 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7244.FBpp0233476
Domain Number 1 Region: 127-617
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.59e-163
Family Calponin-homology domain, CH-domain 0.00000000328
Further Details:      
 
Domain Number 2 Region: 14-94,416-448
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000104
Family Calmodulin-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7244.FBpp0233476
Sequence length 637
Comment (Drosophila virilis)
Sequence
MSDIINVEHHESVEEFKQNLEEMLPDLDANKDGFIDLHELKDALNQVGFKLAGYQVREMI
DEFKSKQRTAHQGKLNLDEFETLCLDLKSKDVASTFKTVVSKKENLETLGGMSSISSEGT
THSVRLEEQLAFSDWINSNLGHDKDLQHLLPIDAEGKRLYQSIKDGILLCKIINHSCPDT
IDERAINKKSLTVYREFENLTLALVSSQAIGCNIVNIDAHDLAKGKPHLVLGLLWQIIRI
GLFSHITLDSCPGLAGLLFDNERLEDLMKMSPEAILLRWVNHHLERAGISRRCTNFQSDI
VDSEIYSHLLKQIAGNEADVNLDALRESDLQQRAEIMLQQAAKLNCRSFLTPQDVVNGVY
KLNLAFVANLFNNHPGLDKPEQIEGLESIEETREEKTYRNWMNSMGVAPHVNWLYSDLAD
GLVIFQLFDVIKPGIVNWSRVHKRFTPLRKFMEKLENCNYAVDLGKQLKFSLVGIAGQDL
NDGNATLTLALIWQLMRAYTLSILSRLANSGNPIIEKEIVQWVNTRLSDAGKQSHLRNFN
DPAIADGKIVIDLIDAIKEGSINYELVRTSGTQEDNLANAKYAISMARKIGARVYALPED
ITEVKPKMVMTVFACMMALDYVPNMDSVDQNNHNNSN
Download sequence
Identical sequences B4M2X5
FBpp0233476 7244.FBpp0233476 XP_002054949.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]