SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7244.FBpp0237175 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7244.FBpp0237175
Domain Number 1 Region: 62-154
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.07e-21
Family Cold shock DNA-binding domain-like 0.00018
Further Details:      
 
Domain Number 2 Region: 150-226
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.55e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 3 Region: 6-62
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 1.64e-17
Family ECR1 N-terminal domain-like 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7244.FBpp0237175
Sequence length 232
Comment (Drosophila virilis)
Sequence
MSTNTSIIMPGERVTIVEDAAKSKRIILGPGLRRVDEKVVATKAGPLRHKEPNTFWVDNY
QRRYVPARGDLIIGIVKARAGDLYRVDIGAADLASISYLAFEAATKKNRPDLNPGDLLYA
RVLNANADIEPELVCVNSNGKRGKLGVLQDGFFFKCSLNLGRLLLRESCPALAALTEELP
YEIAVGVNGRIWVKAHSTRETVGLANAIMTLEQAGYAEIEKICGNLSGVMQA
Download sequence
Identical sequences B4LVK2
FBpp0237175 XP_002052241.1.90633 7244.FBpp0237175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]