SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7244.FBpp0237621 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7244.FBpp0237621
Domain Number 1 Region: 24-86
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000942
Family VWC domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7244.FBpp0237621
Sequence length 102
Comment (Drosophila virilis)
Sequence
MNFRTAIFCSLDSNAVSSSLIPGGHCRDYNGKLYETGMHYMPGPDSCRLCICDSGLPKAC
KMVLCEAFSKCKSFQTVGSGNNCCEVICLDDQFSDGSTDFGI
Download sequence
Identical sequences 7244.FBpp0237621 FBpp0237621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]