SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7245.FBpp0256218 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7245.FBpp0256218
Domain Number 1 Region: 17-76
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.06e-17
Family Calponin-homology domain, CH-domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7245.FBpp0256218
Sequence length 81
Comment (Drosophila yakuba)
Sequence
MPMATATAMAMAYNLALKPADLARDERQHIQKKTFTKWINSHLIDTQCTPVKDLFLDLRD
GHRLLALLSTLTHTSLVSKFL
Download sequence
Identical sequences FBpp0256218 7245.FBpp0256218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]