SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7245.FBpp0256978 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7245.FBpp0256978
Domain Number 1 Region: 661-737
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.63e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.00011
Further Details:      
 
Domain Number 2 Region: 594-667
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.63e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 3 Region: 742-846
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.22e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 4 Region: 449-551
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000107
Family Eukaryotic type KH-domain (KH-domain type I) 0.00056
Further Details:      
 
Domain Number 5 Region: 1072-1141
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.00025
Further Details:      
 
Domain Number 6 Region: 240-311
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000541
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 7 Region: 165-238
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000994
Family Eukaryotic type KH-domain (KH-domain type I) 0.0003
Further Details:      
 
Domain Number 8 Region: 1139-1219
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000111
Family Eukaryotic type KH-domain (KH-domain type I) 0.00065
Further Details:      
 
Domain Number 9 Region: 992-1064
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000278
Family Eukaryotic type KH-domain (KH-domain type I) 0.00058
Further Details:      
 
Domain Number 10 Region: 314-396
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000278
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 11 Region: 376-453
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000175
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 12 Region: 883-932,968-991
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000964
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Weak hits

Sequence:  7245.FBpp0256978
Domain Number - Region: 122-162
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00438
Family Eukaryotic type KH-domain (KH-domain type I) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7245.FBpp0256978
Sequence length 1300
Comment (Drosophila yakuba)
Sequence
MQAAAVMEETNNATTIEQQPIALINGQEQVANEQQPSSPTSVATPTSTTSGGTGNATPAF
SYDDLFPALPANTSAQSQSGASGSTLARVTSSQKTHIVHVPCKERKSTESEKFGEGESKR
ICQQITKETGAQIEIVSGKNQSLTFLIKGKQSELLDARRKILMGFSTQASRQVTVPREHF
RVILGKGGQRLRELERVTATRINIPSQGDESEFITIAGTKEGIAQAEQEIRQLSAEQYKK
SSDRITVPKVYHPFIVGPYSENLNKLQEETGARINVPPQQVQKDEIIISGEKDAVAAAKA
KVEAIFKDMEKKCSTVSVEVAKPKHRYVIGPKGSTIAEILQLTGVSVEMPPNDSPSETIT
LRGPQVALGNALTVVYQKSNSVKSVEINAPHWIHKYVIGRKGANMKQLEEDCPNVNVNCL
EDKIKLEGDPENVDRAVAYLSEIINNYEENFTFEVMTVNPSFYKHIIGKAGANVNRLKDE
LKVNINIEEREGQNNIRIEGPKEGVRQAQLELQEKIDKLENEKSKDVIIDRRLHRSIIGA
KGEKIREVKDRYRQVTITIPTPQENTDIVKLRGPKEDVDKCHKDLLKLVKEIQESSHIIE
VPIFKQFHKFVIGKGGANIKKIRDETQTKIDLPAEGDTNEVIVITGKKENVLEAKERIQK
IQNELSDIVTEEVQIPPKYYNSIIGTGGKLISSIMEECGGVSIKFPNSDSKSDKVTIRGP
KDDVEKAKGQLLELANERQLASFTAEVRAKQQHHKFLIGKNGASIRKIRDATGARIIFPS
NEDTDKEVITIIGKEDSVNKAREQLEAIIKECDEVTEGEVSVDPKHHKHFVAKRGFILHR
ISEECGGVMISFPRVGTNSDIVTIKGAKDCIEAARQRIEEIVADLEAQTTIEVVIPQRLH
RTIMGARGFKVQQVTFEFDVQIKFPDRGATEPVEVLTNGGSGENGGEEGQEGEQQAEKEP
EQEPVRQCDVIRITGRIEKCEAAKQALLDLIPIEEELTVPFDLHRTIIGPRGANVRQFMS
KHDVHVELPPSELKSDVIKVCGTPARVAEAREALEKMIVDFEADKADRELRSYVLQVDVD
TEFHSKLIGRHGAVINKLRADHDVNISLPKRDEPNDSIISITGYQANCEAARDAILEIVG
DPDSLHREVIEIDKRIHPHIIGQRRRNIRKIMEDYEVNIKFPGADQQINSVTIIGHPDDV
ENVKELLLGMAEDFERDFLESVPLTPPTIGAFLTGSGSGSGEGGASESVFVIKDAPWEKQ
KQGKNLNAPNTQSQEDFPHFAAGGAPVAAAPITSVWGPKN
Download sequence
Identical sequences B4P4E5
XP_002091919.1.41174 7245.FBpp0256978 FBpp0256978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]