SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7245.FBpp0258151 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7245.FBpp0258151
Domain Number 1 Region: 57-283
Classification Level Classification E-value
Superfamily L domain-like 5.05e-35
Family Leucine rich effector protein YopM 0.039
Further Details:      
 
Domain Number 2 Region: 663-757
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.3e-21
Family Calponin-homology domain, CH-domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7245.FBpp0258151
Sequence length 1131
Comment (Drosophila yakuba)
Sequence
MAATVYQRLHSVAVGVGSAAGSAIGGGSASFPGSGAGSGSGSGIGNTGNTSSSTSSALLS
HSQLTRSLERILEEAHFSGELILTNRKLKDFPRTGTKYSLTDTVIADLSRNRFAELPEEV
TTFAFLETLLLYHNTIRSIPESVKQLSSLTYLDLRSNQLSSLPREICFLPLQVLLVSNNR
LSSLPDELGRLDQTLTDLDASYNQLANLPARLGELRSLRSLSLRSNHLLYLPRELTCLSL
ISLDVSNNKIASLPLEIRHMSTLVELQLENNPLTSPPASLCMRGLVHVFKFLETQATKDE
KGSRSGGNYDGYTTLRRAPRHNSSGNVLEASTTGSTNNQRRHQVDSGYNTSDGLDKRWSH
DAPAKSKTDSPLHCVSNSAAATLPRSLPSAVHSQADLMDASLTSSTSTIVDESLTLSPTA
SPCKLSYAHSNSSSNGSSPDQDDDIMLDHQERTVHHANGKSGKGLGNIQTYKEYKEALKQ
QRNQENSVYKQKHPNANHSPNDDEDLSPSPTGISNGSSSNTLPKSIMKQNSNQIGHNGNG
NGSANGNGVDDVVIPKKPIQKVIPSRITEIKPASTTGIPSANSSDCLGYVKPQSPMKNGT
SKFNTSNGGGVPPVGIASSTTIKSPVSSTTKLGTVKTHRSVTWNHDIPAEKLSFTMRREF
DRQREETELMSQLRTIIETRLKMTLPVDIASALTDGVILCHLANYVRPRSVASIHVPSPG
VNKLTMARCRRNVDNFLEACRRIGVDEELICSCEDVVPQIEPQQPQLPRADDDYDADVYV
QDDGSSSNDSSHMQCSDDCNSNSNHVYRVPNALALLRTVSALIAMDENPYHKQLHHHLQL
EQQHFEQEQLSEPTTCSQQQEQMLQLQQQQQQLDHVLYENGQPRAENDDGVEDHDDDMGK
RQQQLATVGQMLLKAKQKTYEKIKHNLLSAHGQHNFQGNNNNRMLHTIVENEHDVAAAGP
AGHYQIIDEKQEEPHQQKLEDSKDAAALGNATKEAISKRIEFFEQQKSGKQKLEVFSIYL
PKEKTKGLELEQKIKAKTNEAGSSILKHDSHTLTVILSCVFIATFLWLNLICCAADVLEG
KGAVQVAITVGELFRLHGNGGCGSGNSSGAATPTKSPTRTTRTTLSPTPLA
Download sequence
Identical sequences B4P8S8
FBpp0258151 7245.FBpp0258151 XP_002090474.1.41174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]