SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7245.FBpp0258884 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7245.FBpp0258884
Domain Number 1 Region: 8-123
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.71e-40
Family Calponin-homology domain, CH-domain 0.00000679
Further Details:      
 
Domain Number 2 Region: 165-221
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.0000405
Family EB1 dimerisation domain-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7245.FBpp0258884
Sequence length 249
Comment (Drosophila yakuba)
Sequence
MTDLKLTVALTSVNAENMSRHDMLQWVNNMVQGHFKKIEELCSGAAYCQMMEMIFPNCIN
LKRVKMAAKLEHEYLHNLKLFQEAFNRLKLDKTVPIDRLIKGRFQDNFEFLQWFKKFFDS
QAPGLENIKSLANAPVVKPIKPRQIAAKERSPVNANDDALKELIDEMKTLSLKREDIMEA
SNQIYNKLRLVEDLVNDMINNNQQVELCKRIQTVLYKTIDGEINEEPFEVNEDNGDEGSG
TADPNDGLY
Download sequence
Identical sequences B4PBS7
7245.FBpp0258884 XP_002091849.1.41174 FBpp0258884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]