SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7245.FBpp0258999 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7245.FBpp0258999
Domain Number 1 Region: 1579-1717
Classification Level Classification E-value
Superfamily PRC-barrel domain 7.85e-60
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.0000129
Further Details:      
 
Domain Number 2 Region: 155-282
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000594
Family Calponin-homology domain, CH-domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7245.FBpp0258999
Sequence length 1724
Comment (Drosophila yakuba)
Sequence
MDVETQEIRQARQRASVKWLLSKAFNNRVPDNLKEPFYRDHENQERLKPQIIVELGNATL
YCQTLANLYSDPNYQSMNHWSIIQTLARKGVPVAESADMPITETVLIQTNPLRINAHMSV
IESLMVLYAKEISSGDRVMAAIRRISGNNYQAPTGQSYEQALLGWISHACAALKKRIIKE
VDAGLPDDNGSRLQTPDIPPVRDFQDLCDGICLALLISYYCPKVVPWTSVRINYLPAVED
SIHNILLVCNFSQKHLPYTVMHMTPEDVTYMRGSMKLNLVVLLTDLFNLFEIHPAKCVCY
PGMDGQDVIARRTMGANEHGICHRRGLTVQPVTPIPDLRSDLDQPPVGSPQNRPPFQVPH
SNSFGGGLNRRSTPPNEYQTVQSNNFDANHAEAFVVHKSRGITTLASMHSQQQQLHQQQH
QQHQQQYQQQPLQQHPSQSQLQIQQQEPLVPARLRQAKEKTNVESKADERGDFVAAGRPS
NWEQSRRPSFAGRRSRRNSSSEDSQLTIENFGGSQDQLNTLGRYERDRERKLSNTSVGSY
PVEPAVAVRSSIADARGTLQLSYDTDSGSEKQDRETEKYSMRRQVSVDNVPTVSSHNLSN
AGSPLPVARHKQHSSDKDYSSNSGMTPDAYNDTRSTSAYDPESTPVRKSSTSSMPASPAA
WQLDVGDDDMRSLENASKLSTIRMKLEEKRRRIEQDKRKIEMALLRHQEKEDLESCPDVM
KWETMSNESKRTPDMDPVDLDKYQQSIAIMNMNLQDIQQDIHRLATQQSQMQAQHLQAQQ
LMQAQQIANMLNQAYNAPVSAYSSRPPSRDPYQQQLHHQQQQPMPMPQPMQYVNEHGQYM
SPPQPAHYMPQQTQQPQSIYSDNGAAYNHSNHSPYGGAPQYRSSVVYDDYGQPTNHFYLH
ESSPQPQAHPHPQRRTWAHSAAAAAYEQQQQIQPSLVDVNAWQTQQHQKQKQTWMNRPPS
SAGAPSPGSFMLHQNGGGGGGGGGGGELQHLFQVQASPQHGQRQVSGSNGVQRQQSLTNL
RDNRSPKAPQNMGMPMGMPMQQEDMMAPQSICFIGDEEDVDELERNIIESMQSTHITDFV
HQQQQQHQQQLQQQQRLQGHSGRGSSSEDYDSGEMISNKLNITSGNLTYRIPSPSRPSIQ
ANSFQDPRAMAAAPGAEDQPPEKGFYISFDDEQPKRPKPPLRAKRSPKKESPPGSRDSVD
NQATLKRESLSHLHNNNNIGFGNDDVNSKPVTRHSIHGLNNSNSVKSPGNATYNKYTDEP
PIQLRQLAVSGAMSPTSNERRHLDDVSNQSPQQTQQPMSPTRLQQSSNNAEAAKNKALVI
GADSTNLDPESVDEMERRKEKIMLLSLQRRQQQEEAKARKEIEASQKREKEREKEEERSR
KKEEQMARRAAILEQHRLKKAIEEAEREGKTLDRPDLHVKLQSHSSTSTTPRLRQQRTTR
PRPKTIHVDDASVDISEASSISSRGKKGSSSNLTGYGQLSSNSMKRDYYRGSQDSLTVKE
SPDDYPSTSSTPIGRRGSYKTSREPAGVERGRTLSRISVAKGSTLNFRGRKSNSLMNLCD
SGLGRATPPRRAPSPGMGMGASGPKLYKQPAAKSNRGIILNAVEYCVFPGVVNREAKQKV
LEKIARSEAKHFLVLFRDAGCQFRALYSYQPETDQVTKLYGTGPSQVEEVMFDKFFKYNS
GGKCFSQVHTKHLTVTIDAFTIHNSLWQGKRVQLPSKKDMALVI
Download sequence
Identical sequences 7245.FBpp0258999 FBpp0258999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]