SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7245.FBpp0259704 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  7245.FBpp0259704
Domain Number - Region: 65-180
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0144
Family DBL homology domain (DH-domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7245.FBpp0259704
Sequence length 190
Comment (Drosophila yakuba)
Sequence
MASNPDENNKDPKSEVPPGKDDQMTAYVEKYCYGNDLRTTLTVEKNKKVDVLIAKKYTAL
NYLTHVDNPQNLVANLQLLHSRNANMLKGLYQVVNAKRNAFQAYDVYCKKVLRVKADMQK
QRKCFDEFTGMNYHDLKKIILNSTIEVQEIREKTDLKSVELKKKRELIKASQKSMNNDIR
VLSQIERDAM
Download sequence
Identical sequences FBpp0259704 7245.FBpp0259704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]