SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7245.FBpp0260410 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7245.FBpp0260410
Domain Number 1 Region: 13-132
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.36e-32
Family Calponin-homology domain, CH-domain 0.0000388
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7245.FBpp0260410
Sequence length 495
Comment (Drosophila yakuba)
Sequence
MAPSVPSNVTVASNVTVTHNSMVQWSRGDILEWFNDTLKCSLTKIEHLCTGAAYCNLMHM
LFPDVINLKRVKFVSNQEYEFLANFKELQKAFNMVEVSPPVQVNKLVKGRCVDNFEFAVW
FRHFFVSNHNAERLKGYDVLASRDHQDIGLGSSRSTTPVSATKNRRGIEIVKISPRRGQK
KAAYEDYIETNQNKSPAFKKDDRKQGSTTAEAPVLKPKPGKFPLNQSNTKDKTTKAAMPA
KEPTRFSKRSVRIPPLDLTGICADTPRPMTPAMGTKSTEKPGRQNGTGRTGPTMIQTRKP
SVQNASEPKKKEAAKRIEAVNERIHRPEPEKRSHECKPEKNGPRMEQLGVGKEKESLHKT
NPNENPAKPSNNEKTNNQNNNTQYIHSEIIEIFKSPVYFTEKGSKPKTHDDDSDNDDDDD
DGAIPVELSKNLAKLLTSCELSKEQLLAEVMIHCGLHLYIKNTDDDDDDDVDTAVQTTST
DAASGSQTGKAAKHL
Download sequence
Identical sequences B4PXH9
7245.FBpp0260410 FBpp0260410 XP_002101822.1.41174 XP_015046584.1.41174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]