SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7245.FBpp0264085 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7245.FBpp0264085
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.75e-47
Family Calponin-homology domain, CH-domain 0.000000574
Further Details:      
 
Domain Number 2 Region: 310-373
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 6.93e-21
Family EB1 dimerisation domain-like 0.00026
Further Details:      
 
Domain Number 3 Region: 184-224
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000482
Family Calponin-homology domain, CH-domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7245.FBpp0264085
Sequence length 385
Comment (Drosophila yakuba)
Sequence
MAVNVYSTNVTSENLSRHDMLAWVNDCLQSQFSKIEELCTGAAYCQFMDMLFPNSVPVKR
VKFRTNLEHEYIQNFKILQAGFKKMSVDKIIPVDKLIKGRFQDNFEFLQWFKKFFDANYD
GREYDPVSQRGGVKLGNGNGHGSNGGSGVGSSNNDLHLMHRRPLQPPASSGRMPARVIAS
TGTIIPIDKLIKGRFQDNFEFLQWFKKFFDANYDGRDYDASAVREGAPMGFGSGAGKSLP
GTAASGVSSSYRRGPTATTRPATTSTVKPTVSKVLPRTNNAAPVSRLNAGANSTGTVKKN
DASNSVNNQQIEEMSNQVMDMRINLEGLEKERDFYFSKLRDIEILCQEADDAEAHPIIQK
ILDILYATEDGFAPPDDAPPEDEEY
Download sequence
Identical sequences 7245.FBpp0264085 FBpp0264085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]