SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7245.FBpp0264645 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7245.FBpp0264645
Domain Number 1 Region: 10-115
Classification Level Classification E-value
Superfamily Prefoldin 5.23e-26
Family Prefoldin 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7245.FBpp0264645
Sequence length 125
Comment (Drosophila yakuba)
Sequence
MDKNSAALYKKIQTEVESYQNLQKSCVKMVKQRALLESQLNENKCVLDELNLLGPDNKVY
KLFGPVLVKQELEESRQNVGKRIEYISKELKSSTDTLESMEKDMQKHQETMAKYQQQWQV
AAAMK
Download sequence
Identical sequences B4PFW1
XP_002095546.1.41174 7245.FBpp0264645 FBpp0264645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]