SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7245.FBpp0265902 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7245.FBpp0265902
Domain Number 1 Region: 95-151
Classification Level Classification E-value
Superfamily HMG-box 0.00000114
Family HMG-box 0.0079
Further Details:      
 
Weak hits

Sequence:  7245.FBpp0265902
Domain Number - Region: 18-60
Classification Level Classification E-value
Superfamily HMG-box 0.016
Family HMG-box 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7245.FBpp0265902
Sequence length 158
Comment (Drosophila yakuba)
Sequence
MGATKVKPFSEVECKAMKRFIKSYKKYHADLDEDEVKRSGENAWGKLMPHQKKYFELKPR
EIPAKKILPAARKKTNNKQKKAVSGWRYHARKRAMSKAKPNLSNHVMSAAFIGFLREYHR
RNANLDVKKRLQRAARMWSKLSKTQKNMFRKVVSVFLN
Download sequence
Identical sequences FBpp0265902 7245.FBpp0265902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]