SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7245.FBpp0268521 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7245.FBpp0268521
Domain Number 1 Region: 688-987
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-48
Family Calponin-homology domain, CH-domain 0.0015
Further Details:      
 
Weak hits

Sequence:  7245.FBpp0268521
Domain Number - Region: 1621-1718
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000956
Family Motor proteins 0.013
Further Details:      
 
Domain Number - Region: 1784-1867
Classification Level Classification E-value
Superfamily ARM repeat 0.0123
Family Plakophilin 1 helical region 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7245.FBpp0268521
Sequence length 1954
Comment (Drosophila yakuba)
Sequence
MSAFEITVTPSRLKQKKRAEGREPAVVVMAPFSAKAIVQFEDVPITKTARRQVRVLNPSD
DDIEVKVMKAIREEHNLSLEWMEHTVPARDEVSMELVWSPLLEVACKETLQLIDNRNFRK
EVMIILKSKSNQPVKNPRKFPTVGKTLQLKSPTGAGKTMKSVVSAAVQQKKRLSAAAAPT
SKQTWRVTAPARPAARPHPPPPAPLVEKNVYKPPQEEPVYISPQPRSLKENLSPMTPGNL
LDVIDNLRFTPLTETRGKGQATILPDNLAAWPTPKLNGNVKPSANDMRPRRITPDDLEDQ
PATNKTFDVKHSETINISLDTLDCSRNDGQPHTPLNKTTTIVHATHTRALACIREEEGPS
PPRSPAKSAIHDLKRDIKLVGSPLRKYSESMKDLSLLSPQTKYAIQGSMPNLNEMKIRSI
EQNRYYQEQQIQVKGKDLNSSSSSEASLAGQQEFLFNHSEILAQSSRFNLHEVGRKSVKG
SPVKNPHKRRSHELSFSDAPSNESLYRNETMAISPPKKQRVEDTTLTRSAAPANASARSS
SAHAWPHAQSKKFKLAQTMSLMKKPATPRKARDTSVQASVKLYDSELYMQTYINPDPFAA
TTTMDPFLASTMYLDEQAVERHQADFKKWLNALVSIPADLDADSNSKIDVGKLFNEVRNK
ELVVAPTKEEQSMNYLTKYRLETLRKAAVELFFSEQMRLPCSKVAVYVNKQALRIRSDRN
LHLDVVMQRTILELLLCFNPLWLRLGLEVVFGEKIQMQSNRDIVGLSTFILNRLFRNKFE
EQRYSKAYTLTEEYAETIKKHSLQKILFLLLFLDQAKQKRIVKHNPCLFVKKSPHKETKD
ILLRFSSELLANIGDITRELRRLGYVLQHRQTFLDEFDYAFNNLAVDLRDGVRLTRVMEV
ILLRDNLTRQLRVPAISRLQRIFNVKLALGALGEANFQLGGDISAQDIVDGHREKTLSLL
WQIIYKFRSPKFHAAATVLQKWWRRRWLHVVIQRRIRHKELMRRHRAATVIQAVFRGHQM
RKYVKLFKAERIQAAIILQKFTRRYLAQKQLYQSYHSIVTIQRWWRAQQLGRQHRQRFLE
LRQAAIFLQRIWRRRLFAEKLLAAAATARLQRSQKQQAAASYIQMQWRSYQLGKIQRQQF
LRQRDLIMFVQRRMRGKWSMLKQRNEFQQLKRAAINVQQRWRAKLSMRKCKADYLALRSS
VLKVQAYRRATIQMRIDRNHYCSLRQNVIRLQQRLRATIKMREQRENYLRLRNATILVQK
RYRMLQQMIQDRNAYLRTRQCIINVQRRWRATLQMRRDRKDYLRLQSATRLIQIKYRAKR
EMEKQRAEFLQLRKVTLAVQQRRRALVQMRKERQEYLHLREVTIKLQRRFHAHKSMRFMR
AKYRGTQAAVSCLQMHWRNHLLRKRERNSFLQLRQAAITLQRRYRARLTMIQQLKSYAQL
KQAAITIQTRYRAKKAMQKQVVLYQKQREAIIKVQQRYRGKLEMRKQIPVYQEQRKAVIR
LQKWWRSISEMRLCRAGYRRIRLSSLSIQRKWRATVQARRQRQNFLNTIRKVRLLQAFIR
ATLLMLKQRREFELKRRAAVVLQRRFRARCAMLKARQDYQLIQSSVILVQRKFRANRCIK
QARQEFVQLRTLAVHLQQKFRGKRLMVEQRGCFQLLRRSMPDFQARARGFMARKRFQALM
TPEMMDLIRQKRAAKVIQRYWRGYLTRRRQKHQGLLAIRKRIVQLRHEAKAANSVRCKVQ
EAVRFLRGRFIASDALAVLQRLDRLSRTVPHLLMWCSEFMSTFCYGIMAQAIRSEVDKQL
IERCSRIILNLARYNSTTVNTFQEGGLVTIAQMLLRWCDKDSEIFNTLCTLIWVFSHCPK
KRKIIHDYMTNPEAIYMVRETKKLVARKEKMKQNARKPPPMPTGRYRSQKISFTPCSLPS
LEPDFGIIRYSPYTFISSVYAFDTILCKLEIDMF
Download sequence
Identical sequences B4PV54
7245.FBpp0268521 FBpp0268521 XP_002099191.1.41174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]