SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7245.FBpp0271239 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7245.FBpp0271239
Domain Number 1 Region: 37-223
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 3.21e-39
Family Noggin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7245.FBpp0271239
Sequence length 237
Comment (Drosophila yakuba)
Sequence
MLRQALCPNMKPQSELHWLAVVLTLFAVLGSTQDDADYCAELSTQSLAKILGQAFNPRYM
SIDPPGEPEEKSYHLGYKRSSYELPFYADSDTISVSHFPAWETNHFALVEKKEPPRSKSL
RTRSAFMDRVGHPRIDGFKQRPWECSSKINWIDLGLNYFPRYIRSIECIARKCWYDHFNC
KPKSFTIKVLRRKTGSCIRINDKLILITAEKFENDYTQLWIWEEIAVNFCCECVMLY
Download sequence
Identical sequences B4NZ82
XP_002089065.1.41174 FBpp0271239 7245.FBpp0271239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]