SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7260.FBpp0239249 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7260.FBpp0239249
Domain Number 1 Region: 4-187
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.73e-47
Family Calponin-homology domain, CH-domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7260.FBpp0239249
Sequence length 188
Comment (Drosophila willistoni)
Sequence
MSSNRAPKSGFAAEAQRKINSKYSEELAQESLEWIKAVTAEPINTSGDTDNFFEVLKDGV
ILCKLANALQPGVIKKINESKMAFKCMENISAFLECAKNFGVPTQETFQSVDLWERQNLN
SVVICLQSLGRKASNFNKPSIGPKEADKNVRNFSEEQLRAGQNVISLQYGSNKGATQSGI
NFGNTRHM
Download sequence
Identical sequences B4N3J5
XP_002068214.1.14588 FBpp0239249 7260.FBpp0239249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]