SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7260.FBpp0239660 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7260.FBpp0239660
Domain Number 1 Region: 114-158
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000167
Family Tachycitin 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7260.FBpp0239660
Sequence length 167
Comment (Drosophila willistoni)
Sequence
MSQSQRIKVVLFILYGIFVVGIIGLNIPECDNQDGLITNTLTNCSYGYIYCNATNSQYCV
DAANCSETYFCNATTTTTIATTTAIPTTPSNNISTTSSINSNSTLSSAEVRQRCQLGITG
KYPYPNNSNYYYNCINGYLLVEQCPFCYLFNTDNGSCTGLMANCSFN
Download sequence
Identical sequences FBpp0239660 7260.FBpp0239660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]