SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7260.FBpp0239664 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7260.FBpp0239664
Domain Number 1 Region: 150-210
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000000889
Family Tachycitin 0.007
Further Details:      
 
Domain Number 2 Region: 23-83
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000248
Family Tachycitin 0.036
Further Details:      
 
Domain Number 3 Region: 217-271
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000497
Family Tachycitin 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7260.FBpp0239664
Sequence length 276
Comment (Drosophila willistoni)
Sequence
MSSSMSFLWLFGLCTLLLGCLGDIFEECNDSNNGMYIASSKSCAHYIACEGEDSFEGECG
EGDYFNAQDQVCELMLDVDCRTGLAVQTEPESVPIELGRPEQEAVGQITTLLPTSIAVST
QSSAMSTVTSSASFSNFISTASPSVIVVGTVCPTQDNLNQIVLLPNPNSCTDYFICYHGQ
AQVLSCSPQLHFNPWTGKCDRPENAKCLTTNISAREQCKVHVVDVYPHLDNCNYFYSCNK
GYLMVQQCPISFGWDFEKRSCMEISHAKCYNSKSSI
Download sequence
Identical sequences B4NLW4
XP_002074430.1.14588 FBpp0239664 7260.FBpp0239664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]