SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7260.FBpp0240571 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7260.FBpp0240571
Domain Number 1 Region: 13-114
Classification Level Classification E-value
Superfamily Prefoldin 1.29e-23
Family Prefoldin 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7260.FBpp0240571
Sequence length 148
Comment (Drosophila willistoni)
Sequence
MNTEAAKAAASQEKIVAQFQQLRSEQRNLANSLNTLEMDLREHKTVIETLQSADPERKCF
RLIGGVLCERTVKDVLPQLVENKDFIAKTITIVTDDLSKKGIELNKFKEEHNIKIRGEHL
GADGAPGSKSSDSEGASKSENRNVLVSN
Download sequence
Identical sequences B4N432
7260.FBpp0240571 FBpp0240571 XP_002067920.1.14588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]