SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7260.FBpp0243178 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7260.FBpp0243178
Domain Number 1 Region: 698-997
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.19e-43
Family Calponin-homology domain, CH-domain 0.0016
Further Details:      
 
Domain Number 2 Region: 1624-1720
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000138
Family Motor proteins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7260.FBpp0243178
Sequence length 1966
Comment (Drosophila willistoni)
Sequence
MSAFQITVTPRTKQRKRMEGREPTEVVMAPFSAKSIVQFEDVPITKTARRILRIINTSEE
AIEVKVSKAIKEEHNVTMEWLEHTVPALEEVSMELVWSPQVETACKETIQLLDNRNFRKD
IMVILKSINNQPAKNTRKFPTVGKTLQLKSPTGNIAKIGKVAAAAGQPKKRLSSGVAASA
KPQWRASSACSRPRTAPVTEAKTAPEFAPLCDFNLIKPIEEACYISPKSHQGDSKENVSP
MTPAHVLNMIDKLKFTPLNDTNGPGSIAKVMPDNLAAWPTPILQSHEQLTISITEMKPRR
LTSLELEDQPINNTTFDVKHSETINLSVDTADSSHSELMQLQTPTRAMMNRTTTIVHATQ
QRVLECIREEETFAEKSPVKSRPQDLKRDIKLIGSPLRKYSESMKDLSLVSSQTKFAIQG
SMPNLNEMQQIRSIEQNRYYQEQQVQLKAQKTTKKQDLDASTSSEVSFVGGQQDLHFNHN
EILAQSSRFNLHEIGRKAKANAQKRRSDELSFSDSYSNESLHGVATIGTVITPPKKLRVD
ERIRNAAIPANASAVSTKSWTPTQPKKYKLAQTLSLMKKPQTPRKVKSPIKLYDSELHMQ
TYINPDPFAATTTTDPFMASTMYLDEKAVERHEIDFKKWLNALVSIPADLDGDTNSKIDV
GKLFNEVRNKELVVAPTKEQQSVNYLTTFRLETLRRAAVELFFSKEMCQPCSQVAVYIGK
RSLRIRSDRNLHLDVVMQRTILELLLCFNPVWLRLGLEVVFGEKIQMQSNRDMVSLSSFI
LNRLFRNKLEERKYSKAYTLTEEYAETIKRHTLQKMLFLLLFLDQAKEKRIVMHNPCLFV
KKSPHKETKDILLRFASELLANIGDITRELRRLGYVLQHKQTFLDEFNYAFTNIAIDLRD
GVRLTRVMEIILLRDDLTRQLRVPAISRLQRVYNVKLALGALSSADFQLGGDISAPDIVD
GHREKTLSLLWQIIYKFRSPKFHAAARIIQLWWRRRWLYVIIQRRIREKELRRRHVAATR
IQAVFRGYQTRKSTKIYREERIQAAIILQKCTRRYLAQKQLYMKYRSIVHIQTWWRAQRL
GRIQRKRFLEQRQAAIFIQRIWRRRLFANKLLDAAATLRLQYSQKIQAAAAHIQTTWRNY
CLMKIQRQSYLKQRKLIIYVQQRVRATWLMREQRKEFLQLQQSALCIQQHWRSNILMRKE
RSRYQLIRSSALKLQQHWRGFVLKRSLRKDFLIIKQSTITIQQHWRATIKMRRQREDFLK
LRQSSIQIQRFYRGRLEMLRLRIDFLKTRQSAINIQCRWRAMLRMRQYRSKYVQLVSSVR
LVQIRFRAKHQMLRQRQQYLQLKRAAVVLQQRWRARQLMRKERKEFLQLQTVTLNMQRRF
RATKAMRFMRAKYRGTRAAVNCLQMHWRGHLMRQRERGHFLALRKAAITLQRHYRARLAM
LRQRKSYELLRHTVIQMQARYRAKLKMRQQRCLYQKQRELIIYVQQRFSATIKMRKQRFI
YQSQQKAVTRLQDWWRGLREMKRLRLDFKRLQQATLTVQKRWRAILEGRRQRVIYMATVN
KLRLLQCRVRATLLMRRQRQQFQRQRLAAITLQRRFRARQLMIKERNDYVQLKRGVLLVQ
RKFQATRLMRQERQQFVHLRGIVIHIQQKFRGGRLMLEQRKHFQLLRSSTLIFQASVRGY
LARKRFQKLMTPEMMEEIRRKRAARTIQRYWRGYCARRKHGKKLVDIRKRLQQLRREALV
ANSVRCRVEDSVRFLRGRFIASDALAVLTRLDNLSRHVPHLLMWCSEFMATFCYGIMAQA
IRSEVDKLLIERCSRIILNLARYNSTTVNTFQEGGLVTVAQMLLRWCDKDCEIFNTLCTL
IWVFAHCPRKRRIIHNYMNNTDAIYMIRETKKLVARKEKMKENTRKYQPQSSSLGRHPNR
QARTFQPCALPSREPDFGVIRSSPYVFQSSVFAFDTILLKLGIDMC
Download sequence
Identical sequences B4NL42
7260.FBpp0243178 XP_002073259.1.14588 FBpp0243178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]