SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7260.FBpp0244305 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7260.FBpp0244305
Domain Number 1 Region: 26-73
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000374
Family Ovomucoid domain III-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7260.FBpp0244305
Sequence length 73
Comment (Drosophila willistoni)
Sequence
MKYFTIVSVIALIMAMMMLSPVEGSFCPCNLKEKGEVCGSNGVTYKNRCEFDCTQRDYKK
LGRKLNIQKMGTC
Download sequence
Identical sequences B4MVZ3
FBpp0244305 7260.FBpp0244305 XP_002064877.1.14588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]