SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7260.FBpp0245316 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7260.FBpp0245316
Domain Number 1 Region: 1020-1124
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.88e-30
Family Calponin-homology domain, CH-domain 0.0000992
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7260.FBpp0245316
Sequence length 1126
Comment (Drosophila willistoni)
Sequence
MIKLKSLFRRGQGTSSSNSSQNSTSAHKQQQQHSNNNRQKSQSSTSLNTAHEQHQQQQQQ
QPATTATTKFYSNNEGGTGATYERGVDVGDEDALLLTNQLQQRRQQQQQQQQQQSNTLPQ
KKSKLKGQKQPKQLPPIQQQQPPGNDLNEQQMTSIAAAPHQPPPTVTSAAAAAAAATSSV
NNRNLNLNNNSGHALAGVSAAAAAADFYQQLAVAAAATASATATPTTTPGTASANAFPAA
AATVAVAAVAASSYQQQQQQQQQQQQLINNEQQQKQLLEANNKMQELHKQVERLESEHLQ
LETRITELLPYQSEVAKLKGDLIKMQNLQEKTQMEIGNLKYENESLRNRLRDVVNSPLSD
AEKHQIIQDSQRLHSSAPASIALPSAIEGIHDSGTPCLTPDWDKHSSSSEISVACLQDKI
IQMEETHYSTNEELQATLQELADLQTQLTDTQTENERLSEEKDVLFQSLCRQTEKLNESR
TQITTLQELLLRDTKQAAEVTTSEREKKLLDLIKTSQEEREVVLLKQEELNSELSELRSV
CDAAQLEQQRQRERIALQDSQLDASNAERKQGESQLSQAKEEISQRGIEINRLTTLLENA
RSKIEELEADLSRGDKTDLSDVLDAARREKDTLEERVAELQDQCSRGQAELRRLREQLAG
LSEECKVAKNNAKCAVSHLEYRLEQLQSDKDKVASDCQSLEERVAELQVQCKCHQEDKAQ
LQQLLSETQRHLGDIKLKFSDTEQRLDKETQLRRKEAEEWQQFQSDLLMTVRVANDFKTE
ALSAREQLLLENKTQKEKIRLLEQQLDKLNTKSAETQQSVISTVQLEMASRRGSKHNFNR
QDSRLSVKTLIESIENNKPQGKSSDDVESRYSSTSSLNSGTPEMGNTPIILPASSDWHES
LRLPVLQSSNLHVSVNNTAAIVGGGGGGGGGGAVNATKVTLPLREQQQLPATTGSAASTL
PPTPATPPPSMVVVPSSLTTPVKTPSNSQLVGSLSFGNVSKSFLTGERKDPLNMLAKNGG
SKRNALLKWCQNKTVGYRNIDITNFSSSWNDGLAFCAILHSYLPDRIPYDTLNPTNKRRN
FSLAFAAAESVGIGTTLNINDMCQIERPDWTQVMSYVTAIYKYFET
Download sequence
Identical sequences B4N262
XP_002067465.1.14588 7260.FBpp0245316 FBpp0245316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]