SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7260.FBpp0245382 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7260.FBpp0245382
Domain Number 1 Region: 11-80
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000000111
Family Calponin-homology domain, CH-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7260.FBpp0245382
Sequence length 256
Comment (Drosophila willistoni)
Sequence
MAINEFVFKDDEELRDGVIWCRLLNRVHPGSIRLKSVKQKSDSVVDWYANYQLLHAALQK
LDIPVDLSVRNLIDGQDVEIGHAVCFFIEIYLKKKEKRRQISPTIEQIDDKRKDNVTKTL
PAGLGLDFIPKFRNFFSFDKPKREYARLLDESLEEKAYKQKEKLKHLQQQRHGSPVNQGE
RKLGGGDRQEQHETTPQQQVDDNSFLVAVNNKLETKQRGLYKLLQMCTELEKTELQMEKL
WLQKRQKRKMRHAQCL
Download sequence
Identical sequences 7260.FBpp0245382 FBpp0245382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]