SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7260.FBpp0246377 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7260.FBpp0246377
Domain Number 1 Region: 40-178
Classification Level Classification E-value
Superfamily Globin-like 0.0000000000000214
Family Globins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7260.FBpp0246377
Sequence length 215
Comment (Drosophila willistoni)
Sequence
MSQNGSVIETEPKTREKIEYSAPIFPKVLPVVIPGGQYDELGFSLTEKVALRQAFDLIKP
FRRKMGKDIFYTYLVQHEDVIDIFRKNGDLDEKINLTALHKHAQTMMRTIHFVVNKGLDD
MPSFHMMAHDIVNIHVDHWVPKAHVQLLGLAIRDYVLNVMSNRCSESLISGFDKVLNKFL
GCGEPAPKIRTHNPVAFREVSVFEISDSKDNEVVE
Download sequence
Identical sequences FBpp0246377 7260.FBpp0246377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]