SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7260.FBpp0247095 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7260.FBpp0247095
Domain Number 1 Region: 167-283
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.83e-45
Family Calponin-homology domain, CH-domain 0.00000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7260.FBpp0247095
Sequence length 288
Comment (Drosophila willistoni)
Sequence
MTSHSYYKDRLGFDPNEVQHEQQLQQQQQHHHSTNSMKRSSSRQTHHHHHTQQQQHSHHQ
SYHHAATSSSQSPARISVSPGASNGHGHGSLEYHQAQREQRDRGDLYATNTNQHHSNNHR
HSTSASPLYETSAPKKAKHSSSTQPQPQGGYEDALTQFKGSMSIWDHFIEDWDIMHERDA
IQKKTFTKWVNKHLKKANRRVVDLFEDLRDGHNLLSLLEVLSGEHLPREKGKMRFHMLQN
AQMALDFLRYKKIKLVNIRAEDIVDGNPKLTLGLIWTIILHFQECLKP
Download sequence
Identical sequences FBpp0247095 7260.FBpp0247095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]