SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7260.FBpp0249255 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  7260.FBpp0249255
Domain Number - Region: 15-93
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000546
Family Calponin-homology domain, CH-domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7260.FBpp0249255
Sequence length 247
Comment (Drosophila willistoni)
Sequence
MHTISHKNLTVEEVEEVHKWLKENNINIQKLRRDFSDVMPLAELLKRAYPRIVDLYNYPK
KNSVHLKIINWETFNFKVLAKFNLTLSRELMEMLANGVPGAAEVLMHEIIRLEKRQRLAV
ERNANMRREQTWEENDEVKTVIISKQVGDGIVQVPQKMILYSLYEKMARDGQAKDVIIDA
YQQRLAHMENIIKLKTERIDELLMQMGKSMEKKPIMSSGTSGTVFIYEATDPPRRRQPPA
PAPSAEQ
Download sequence
Identical sequences B4MT83
FBpp0249255 7260.FBpp0249255 XP_002064336.1.14588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]