SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7260.FBpp0249982 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  7260.FBpp0249982
Domain Number - Region: 2-85
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0206
Family Extracellular domain of cell surface receptors 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7260.FBpp0249982
Sequence length 125
Comment (Drosophila willistoni)
Sequence
LDCYICSYVEGQTDMSCLNNVSSLPVINCTQKYCLTVREEYLKKPSQVRSFLRDCKEKPL
LVNGIRTDDTCRTYHRSCQQNLCNGHNGRVNNSTTGSDGAGYGGNHNGIIPGKSNGHQHW
QHQVA
Download sequence
Identical sequences FBpp0249982 7260.FBpp0249982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]