SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7260.FBpp0250463 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7260.FBpp0250463
Domain Number 1 Region: 46-180
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 4.95e-29
Family Insect phospholipase A2 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7260.FBpp0250463
Sequence length 188
Comment (Drosophila willistoni)
Sequence
MWLLRCFVITTAFVWAFASGFGDDAIFEDEDIYNQALPPVPHTGITAPGTKWCGPGNTAA
NYDDLGTESGTDRCCRAHDHCDEIMESRSSLHGLPTNTDWFPILKCTCEQEFINCLQAVD
TLTSNTLGRIYYGTRSKCFAQGYPTTGCKEYQNGTLRKRCIRYNVNKSLAKIWQFYDMPF
YSKQAMKG
Download sequence
Identical sequences B4MR69
7260.FBpp0250463 XP_002063622.1.14588 FBpp0250463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]