SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7260.FBpp0252440 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7260.FBpp0252440
Domain Number 1 Region: 1560-1698
Classification Level Classification E-value
Superfamily PRC-barrel domain 2.35e-59
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.0000131
Further Details:      
 
Domain Number 2 Region: 199-291
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000017
Family Calponin-homology domain, CH-domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7260.FBpp0252440
Sequence length 1705
Comment (Drosophila willistoni)
Sequence
MDAETQEIRQARQRASVKWLLSKAFNNRVPDNLKEPFYRDHENQERLKPQIIVELGNATL
YCQTLSNLYSDPNYQSLNHWSILQTLARKGVAVAESSDMPITETVLIQTNPLRLNAHMSV
IESLMVLYAREISSGDRVTAAIRRISGSNYQAPPGQNYEQGLLAWISHACAALKKRIVKE
VETGLPDENGSRLQTPDIPPVRDFQDLCDGICLALLISYYCPKVVPWTCVRINYLPAVED
SIHNILLVANFSQKHLPYGVFHMTPEDVTFMRGSMKLNLVLLLTDLFNLFEIHPAKCVCY
PGMDGQDVIARRTLGANEHGICHRRGLTMQPVMPIPDLRSDLDQPPVGSPSNRPPFQVPH
TNSFGGGLNRRSTPPTEYQASAIQSNNYDGNHAEAFVVHKSRGITTLSSMHSQHQQQQQQ
QYHQQPQQQTQQQQQQEPLVPARLRQAKEKSNVESKADERGDFVAAGRPSNWEQSRRPSF
AGRRSRRNSSSEDSQLTIENFGGSQDQINTLGRYERERDRERKLSNTSVVEPAVAIRSSI
ADARGTLQLGYDTDSGSEKQDRETEKYSMRRQASVDNVPTVSTAHHNLSNAGSPLPQARN
KQHSSEKDYSNNSSAGIADQLYNDARSTYGDPESTPVRKSSTSSMPASPAAWQMEVGDED
MRSLENATKLSNIRMKLEEKRRRIEQDKRKIEMALMRHQEKEDLESCPDVMKWETMSNES
KRTPDMDPVDLDKYQQSIAIMNMNLQDIQQDIHRLATQQSQMQAQHLQAQQLMQAQQIAN
MLNQAYNAPVSTYSSRPPSRDPYQQQQAPPPMAMPQPMQYVNEHGQYMSPPQPAHAYMQP
QSLYSDNGGGPYNHNHNHSPYGAPPPQYRNSVVYDEYGQPTNHFYLHETSPQPPPQRRTW
AHSAAAAAYEQQQHQVQQPLVDVNAWQTQQKKQGWHNRPLSSAGGAPQGSFVLHQNGSGG
GGGDLQHLFQQQASPQHSQRPMSGANGVQRQQSLTNLRDNRSPKTNPQPMAMPMQMQHED
LMAPQSICFIGDEEDVDELERNIIESMHSTRISDFVVQQQQQQQQQHRGHQGQSGRGSSS
EDYDSGELISNKLNITSGNLTYRIPSPSRPSIQANSFQDPRGGAEQEDSTAEKGFYISFD
DDQPKRPKPPLRAKRSPKKETPGGGRDNVDNQVVFKRESLSQLHNISMSSEEASKQPVNN
ARHNRPNNNNSNSVKSTQNTNSGNATYNKYTDEPPIQLRQLAVNTSEPGSSLERRHLEDL
TNQPPQLQQQQPMSPTRLQHSSNTAEAAKNKALVIGADATSLDPDSVDEMERRKEKIMLL
SLQRRQQQEEAKARKEIEASQKREKEREKEEERARKKEEQMARRAAILEQHRLKKAIEEA
EREGKTLDRPDMHVKLQPQTASSSTPRLRQQRNTRPRPKTIHVDDASVDISEASSISSRS
KKGSGSNLTGYGQLSSNSMKRDYYRGSQDSLTVKESPDDYPSTSSTPIGRRGSYKTSREP
AALPERGRTLSRISVAKGSTLNFRGRKSNSLMNLCDSGLGRATPPRRAPSPGMGMASMGM
GASGPKLYKQPAAKSNRGIILNAVEYCVFPGAVNRDAKQKVLEKIARSEAKHFLVLFRDA
GCQFRALYSYLPETDQVTKLYGTGPSQVDEVMFDKFFKYNSGGKCFSQVHTKHLTVTIDA
FTIHNSLWQGKRVQLPSKKDMALVI
Download sequence
Identical sequences FBpp0252440 7260.FBpp0252440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]