SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7260.FBpp0254666 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7260.FBpp0254666
Domain Number 1 Region: 16-127
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.11e-28
Family Calponin-homology domain, CH-domain 0.0000893
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7260.FBpp0254666
Sequence length 135
Comment (Drosophila willistoni)
Sequence
MSLKNVIESPYERYPPRTELLEWVNRTLKLCYTRLIDLRTGTAYCQLFHMLKPDAINMKM
VKWTTKLDEDHIANFRLLQKGFHHACVHKEIPVNLLVKDEFLDHLDFLRWFHKFFMLNRS
AAAANYDEWAASILL
Download sequence
Identical sequences 7260.FBpp0254666 FBpp0254666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]