SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 73239.Q7RB14 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  73239.Q7RB14
Domain Number - Region: 131-178
Classification Level Classification E-value
Superfamily VPS9 domain 0.0536
Family VPS9 domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 73239.Q7RB14
Sequence length 283
Comment (Plasmodium yoelii yoelii)
Sequence
MSYKVVYILFHILFCNLINTIDEYFNDDQKTPEKYNSRDLLKSFFSDSEDCSGEENIIYG
FILLLNMFGEEDIDSDKIVEYAILWLINKINQKKKNETIMLDYFYTDYIKSNSCYNKHIS
DNSDSNNNKDDIICKKIKSMNIDIKDISNFYDAFKSLCNMYSEIGEEKEPQCKKCLENAG
ELFEKYEKLKNDLNINKGSSYYELLSSLSNDYRNFEQMYNTIWCSSISPLVACPRSSVTK
NILITIAIIFVAASILLGVSYKYSLFGFRKRSQKQHLREMLKK
Download sequence
Identical sequences Q7RB14
73239.Q7RB14 2136.m00049|PY06335|PY06335|putative XP_726968.1.76580 gi|82705434|ref|XP_726968.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]