SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 73239.Q7RB52 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  73239.Q7RB52
Domain Number 1 Region: 1-117
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.08e-19
Family Calponin-homology domain, CH-domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 73239.Q7RB52
Sequence length 401
Comment (Plasmodium yoelii yoelii)
Sequence
MNNEMKIGKEELVEWVKNVLKXKNFNFNDLKNGDIYLELFEYIWPHAMKKYKGCIFVNPI
NDIDKKKNWNVIKTILNNVNIDINFINYDEICKNSFIECYQSLIILYFLYSLVKNKECNF
TLAYPINKELTNFMSNEKPLNCLVNCKSVKLSECVIKNKQYSQIDNMVDNKIDNLYTNHI
NCINELNFKNKKTEKNILDSNIFPKNYINNKSQINSSSIINDDFMYSQNTESPKSFYSQK
FKKKKKKNDNYTIENKIKEKCVTELDENYSLHKTKQNNKYNKNLFFYNSLKNFEKNSDYI
KSSTVSNVSSSSEKSESISEKSANNHIKTKSSLLLDKIYYNEKKENEKKINPLHNFYDRE
KIPKSNFFKYFNIEENINEENKNDENKNDENKNEENKNEEK
Download sequence
Identical sequences Q7RB52
XP_726922.1.76580 2116.m00026|PY06296|PY06296|hypothetical gi|82705320|ref|XP_726922.1| 73239.Q7RB52

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]