SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7425.XP_001599201 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7425.XP_001599201
Domain Number 1 Region: 33-257
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.05e-65
Family Calponin-homology domain, CH-domain 0.00019
Further Details:      
 
Domain Number 2 Region: 2732-2839
Classification Level Classification E-value
Superfamily E set domains 6.21e-26
Family Filamin repeat (rod domain) 0.00071
Further Details:      
 
Domain Number 3 Region: 2629-2743
Classification Level Classification E-value
Superfamily E set domains 1.07e-25
Family Filamin repeat (rod domain) 0.00086
Further Details:      
 
Domain Number 4 Region: 2160-2274
Classification Level Classification E-value
Superfamily E set domains 9.55e-23
Family Filamin repeat (rod domain) 0.0038
Further Details:      
 
Domain Number 5 Region: 2529-2649
Classification Level Classification E-value
Superfamily E set domains 3.4e-21
Family Filamin repeat (rod domain) 0.001
Further Details:      
 
Domain Number 6 Region: 1474-1569
Classification Level Classification E-value
Superfamily E set domains 1.87e-19
Family Filamin repeat (rod domain) 0.004
Further Details:      
 
Domain Number 7 Region: 1915-2006
Classification Level Classification E-value
Superfamily E set domains 2.54e-19
Family Filamin repeat (rod domain) 0.0021
Further Details:      
 
Domain Number 8 Region: 1571-1651
Classification Level Classification E-value
Superfamily E set domains 1.2e-18
Family Filamin repeat (rod domain) 0.0027
Further Details:      
 
Domain Number 9 Region: 1828-1918
Classification Level Classification E-value
Superfamily E set domains 1.73e-18
Family Filamin repeat (rod domain) 0.0059
Further Details:      
 
Domain Number 10 Region: 1736-1828
Classification Level Classification E-value
Superfamily E set domains 2.27e-18
Family Filamin repeat (rod domain) 0.0034
Further Details:      
 
Domain Number 11 Region: 268-365
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.41e-18
Family Calponin-homology domain, CH-domain 0.0025
Further Details:      
 
Domain Number 12 Region: 1215-1291
Classification Level Classification E-value
Superfamily E set domains 8.01e-17
Family Filamin repeat (rod domain) 0.006
Further Details:      
 
Domain Number 13 Region: 1381-1471
Classification Level Classification E-value
Superfamily E set domains 5e-16
Family Filamin repeat (rod domain) 0.0049
Further Details:      
 
Domain Number 14 Region: 1656-1747
Classification Level Classification E-value
Superfamily E set domains 6.21e-16
Family Filamin repeat (rod domain) 0.0033
Further Details:      
 
Domain Number 15 Region: 458-552
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000193
Family Filamin repeat (rod domain) 0.0022
Further Details:      
 
Domain Number 16 Region: 2273-2364
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000394
Family Filamin repeat (rod domain) 0.0054
Further Details:      
 
Domain Number 17 Region: 548-639
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000044
Family Filamin repeat (rod domain) 0.0052
Further Details:      
 
Domain Number 18 Region: 2368-2455
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000507
Family Filamin repeat (rod domain) 0.0031
Further Details:      
 
Domain Number 19 Region: 1022-1110
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000594
Family Filamin repeat (rod domain) 0.0027
Further Details:      
 
Domain Number 20 Region: 2086-2180
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000771
Family Filamin repeat (rod domain) 0.0055
Further Details:      
 
Domain Number 21 Region: 940-1023
Classification Level Classification E-value
Superfamily E set domains 0.000000000000024
Family Filamin repeat (rod domain) 0.0063
Further Details:      
 
Domain Number 22 Region: 1292-1383
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000387
Family Filamin repeat (rod domain) 0.0053
Further Details:      
 
Domain Number 23 Region: 1112-1204
Classification Level Classification E-value
Superfamily E set domains 0.0000000000034
Family Filamin repeat (rod domain) 0.0071
Further Details:      
 
Domain Number 24 Region: 373-460
Classification Level Classification E-value
Superfamily E set domains 0.00000000026
Family Filamin repeat (rod domain) 0.0068
Further Details:      
 
Domain Number 25 Region: 2000-2077
Classification Level Classification E-value
Superfamily E set domains 0.0000121
Family Filamin repeat (rod domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7425.XP_001599201
Sequence length 2870
Comment (Nasonia vitripennis)
Sequence
MQEKGQSDRLEPAELVGLVARSAEGTAAKGMPIKGHEDLWVDIQANTFRNWVNEHLKQSD
RGRECGPVLDLADDFRDGTRLCALVEILTCKRLAKWNPNPVNQHHYLENVSTALKAVEAD
GVKLVNIGNVDIVNGNLKLILGLIWSLIVRYQIGKSKFPPRKLMLSWLKAVLPECRVNNF
TTDWNSGVYLSALLNYCKPGLFPHWRQLDPNDSVYNCRKAMEISKREFDIPMVLQPEYLA
SPYLDELSGMTYLSYFMKEGSPGFHSTLRWVNSQLPHSPVRNFTTDWNDGRALCSIVRNL
GGPAPAYDKIDTSPLSWEHNLQMGIDGGKKLGVEPLLKAKDMADQNVEHLGVMAYAAYFQ
WVKPRPQVSEQVAVHIDSTSARVHQPAYFKLELLSKEVNTRDVRGEVIGPSGCMECRLSW
NGAHGKGTFVPTEVGMHKLMVYNDGELLNGCPYYFRVHPPLTKIKSPGMDPCAIGSIVEV
LVNSYGTSQEGINVTAWSPAGRALSCPVRENDGVHVATFQPDETGEWSIAITHKGAHIQG
GPFTCFVFDPNGVQLHDLDGAIPGQSFAFTVDATSTGGLGDIVIDIVHDKQSVPHFIQEL
SHMNYRVSFVPRDLGKYRVYVYFNGSDVRGSPFSLRVGTSRGSRRSRESSHAGSLERSNI
ASLERKRNGHHTPDNGSTPTALRSPVYKSPSPSSYTSTYNKTFDRVNNHHSSTKNSHSPP
LINERKDTYATNMYNQLHNKSPTWSSPNFYDRSKSPSMSPKPGDQDHHKFHSNRLSIAVS
SMVGGSARRDSWDAIAKTKSLLSSNSLESLANLANDSLTIDNTKSTTTNNVNEQITENYT
QNSSSNYSSLKKFSSSEYNYSPKVNNDSLSNSRGILKNKVHSTLGLDTTDTMGRSAAAES
SATTTTTSTTTTMKTIQEKQQYLNSDSSFLRNSFGHDKLVSGSALEMLAIHRPTSFILDS
SLEASKIAVIVTGPNGRPVPVQKSTLQGQTYTVTADQVGEHTIQILYNGKHIKGSPFRSQ
AYNSKAIQVGSIPNGVVNEPVEFEIDGSRAGSGNLEILVNGGHVTSFVRTLSSQRFLASF
VPHEAVTHLVEMTFNGESVPGSPWKVGIMPSPKMSVVGDSVRLVPAGSPAVFELSALGFS
SNEIQVQILTPSKRQIGARIDEEPSRTGEFRVSFTPQEVGSHLVEVSIAGQKLPAGPLVA
KVYNSSLIQVTEVPSAVVGHACQFRVDASAAGEGQLEISINEGEVPNHVQVVGGGRCLVS
FTPEAAKPHYIDIKFNGEPVPGCPFVCHVSDTSRVSLELAHLELLPVSEPASFHMAVDGS
GSAELAVSVRGPSSELPVKVTGDIHTGFTAEFTPREVGVHAVSVEYNGHPVNGTPFLAKA
FDAERVVIGPVGRASVGQAQHFNVDASQAGEGNLEITISARGQNIPTQVTPQGNARFSVG
FVPFEACEHMINIAFNKRTVPGCPIIARVAPDAHVTVSGQALSSAPLGRQSALTLSNVAG
SLEDLEVNVEGPNGQAVPAQVTDNKDTTCTVAFTPRIVGEHRISVSHRNLPVLGSPFSCK
VYDVSAIKVKDAKKGVIGLPVTFLVETSQAGPGNLEVTVNGGRVPTSAQAQGPHTYAISF
TPREPTIHTVDLRFNGEDVPGSPFTCQVTDTAKVIVTEALEKVSVNRVASFVIEADSTPT
VDVLAPTRESLPVEIEQIGSGSYSAGFTPKDVGDHSVQVKLNGAHLQGSPFLVKAYNADQ
VKVTDINSGVVGKPVFFSINASQAGAGNLEIIVAVNGKNVPNFVQSEGNAKFRVNFKPQE
AALHSLSVRFNGEPVPGSPFTCQVLGAGQALISGHNLKMAAVKQPISFTIDPQASSSKCD
VIVTPPSNIALPITIEPQDLKYKITFTPTEVGRHNVSVLVDGESIKGSPFACNVYDVTKI
HVSGLSEAFLGQATTFTVDAAQAGEGTLELVVSTENNTVKAEVVACARGLYDVTFVPQTS
STHYVNISFNDDNVPGSPFKCPVIGSILDGPSMIRVGNTAFMDLDMVGLSGPITAEVTGP
DGIIIPCNMTKIDSNLHRVEIKTRNVGTYNVVFSQGSKIISSQSLQAFDPTKVVIQEVSD
AVCHRPGTIFVVAPKEAGPGKLTVSVRSGGAEVDSLVREKDNGIYEIIFHPTRTAPHRVH
IKYNDVYIQGSPLEVAVRGPTGGREVTATGLGLYQSCIGKVTSFSIETLGRPGKEFDVVI
SSPQGNAVPVRCYQHRDGNLLAEFTTNSVGTYKIDVLHGAKPVLGSPFFCQAFDASKIKL
QELGPTTVSVHDHFALKIIKAEAGVAELDVAATSPLGQELAMQVRPLNDGAEMIEFSPSV
AGSYVINVSYGGCTVPGSPVVVVAEAAGQARAKGQGLIQGHVGKPAHFLVTGSRSPPAVQ
VDGPDSVAKPTVEAGPNPGTWNVSYVPTEPGLFDVRVVCAGQQLPGSPWHPRIIDTRNLR
VIGGWSALCDELGRLKIAPGNKISFDTSEAGPGELSGRIDDQPLKFEMTTNNRLKLIIPQ
LAAGEHGMEILFNAVPFPGAPKLAIAPELESSMSQDTSRVMLRGRGLTAAKCGEQVSFTI
DGSQAGTGTPQVQIFSPTSEVDVSIQHLGNNVYRASYTPFTPEPLLMTVSWNGRQLKGCP
LQISVSSAADATRVVCSGQGLKYGVVGQEIRSFIDTRRAGPGELTAHCVGPHKVAYCELY
DHGDATFTLNVKPQEPGRHALTIKYAGEHVTGSPFTLKVSGAPDASKVRVYGPGIEHGVL
ATFQSRFICDTRGAGAGQLTVRVRGPKGAFRVEMQRETQKDRIILCRYDPTEPGDYRVEV
RWAGVLVPGSPFPVKIVDTQDELLMLTQGTDTCTTGHHTITSWRGSQAIL
Download sequence
Identical sequences K7JAP5
7425.XP_001599201 gi|156552673|ref|XP_001599201.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]