SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7425.XP_001602426 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7425.XP_001602426
Domain Number 1 Region: 32-261
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.75e-82
Family Calponin-homology domain, CH-domain 0.0000047
Further Details:      
 
Domain Number 2 Region: 4074-4234
Classification Level Classification E-value
Superfamily Spectrin repeat 1.04e-31
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 3 Region: 4515-4663
Classification Level Classification E-value
Superfamily Spectrin repeat 2.95e-28
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 4 Region: 3097-3255
Classification Level Classification E-value
Superfamily Spectrin repeat 1.58e-27
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 5 Region: 3964-4112
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-25
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 6 Region: 4292-4451
Classification Level Classification E-value
Superfamily Spectrin repeat 6.16e-25
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 7 Region: 272-388
Classification Level Classification E-value
Superfamily Spectrin repeat 1.61e-23
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 8 Region: 5056-5132
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.44e-22
Family GAS2 domain 0.00049
Further Details:      
 
Domain Number 9 Region: 2663-2817
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-22
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 10 Region: 3866-4013
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-21
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 11 Region: 3522-3670
Classification Level Classification E-value
Superfamily Spectrin repeat 2.26e-21
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 12 Region: 3636-3788
Classification Level Classification E-value
Superfamily Spectrin repeat 4.71e-20
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 13 Region: 3213-3364
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-19
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 14 Region: 676-803
Classification Level Classification E-value
Superfamily Spectrin repeat 4.46e-19
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 15 Region: 1855-2002
Classification Level Classification E-value
Superfamily Spectrin repeat 3.24e-18
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 16 Region: 4736-4859,4916-4948
Classification Level Classification E-value
Superfamily Spectrin repeat 4.57e-18
Family Spectrin repeat 0.0081
Further Details:      
 
Domain Number 17 Region: 2391-2496
Classification Level Classification E-value
Superfamily Spectrin repeat 7.98e-18
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 18 Region: 3316-3467
Classification Level Classification E-value
Superfamily Spectrin repeat 1.24e-17
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 19 Region: 2876-3025
Classification Level Classification E-value
Superfamily Spectrin repeat 7.92e-17
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 20 Region: 2059-2175
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-16
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 21 Region: 2567-2703
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000746
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 22 Region: 2244-2387
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000785
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 23 Region: 585-720
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000485
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 24 Region: 4965-5057
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000138
Family Calmodulin-like 0.029
Further Details:      
 
Domain Number 25 Region: 1158-1262,1295-1325
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000785
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number 26 Region: 3789-3908
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000134
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 27 Region: 1438-1525
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000811
Family Plakin repeat 0.0022
Further Details:      
 
Domain Number 28 Region: 1745-1850
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000142
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 29 Region: 926-1075
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000196
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 30 Region: 1612-1735
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000892
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 31 Region: 1536-1642
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000798
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 32 Region: 2500-2601
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000224
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 33 Region: 1084-1188
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000004
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 34 Region: 399-492
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000417
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 35 Region: 519-583
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000863
Family Spectrin repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7425.XP_001602426
Sequence length 5350
Comment (Nasonia vitripennis)
Sequence
MEFELDGSLKEWAKDKPLSILQLDPADRAVLKIADERDAIQKKTFTKWVNKHLKKASRHV
GDLFQDLRDGHNLISLLEVLSGEHLPRETSGSMRFHMLDNVRIALRFLQCKNIKLVNIQA
EDIVDGNPKLTLGLIWTIILHFQISDIVVGQESHVTAKEALLRWARRSTARYPGVRVSDF
TSSWRDGMAFSALVHRNRPDLLDWRSARTWQARERLERVFYVAEREYGVTRLLDPEDVDT
PEPDEKSLITYISSLYDVFPEPPAIHPLYDAEAQRRLGEYRELASSLHLWMREKMSMAQD
RYFPPTLIEMKKLAADSAKFKSDEVPSRHRDKLRLSHIFRELQKYFESVGEIDIEQELHI
DLIEKNWNRLMILHQERDQAISDEIKRLERLQRLAEKVHREMKSTDNRLEELERRVEEDA
RRLDRLHPLEAKHAVDLLEQDIRNTELQIQNIFADVHSLTEGRYSQAADLHKRVQKLHQR
WVGLRSLLHKRLVQPLSDVSFPVEERVVTKHRTTVHETRLVDTNPHFRALHDCIDWCKSK
LKQVNEADYGSDLPGVQSELDIHQREHKAIEQFHTKVERCVQAKSNFHGEELALYSQHLG
QLQKIYTELITLSNKRMTDLETLHDLIQSATGELVWLNSKEETEVTRDWSDKNLVVRNVE
QYYESLMSDLEKREIQVSAVQDRGEGLVLQHHPASKTIEAYMTAIQSQWAWLLQLTLCLE
VHLKHASQSQQFFREVQQAEQWISKRDEILNTVYSQSEFSLDEGERLLRGMQELRDELNN
YGPHVDGLVEQAKVIVPMKQRRQPVTRPIQVTCICTYKQVNMAIEKNEQCTLYDNSGRVK
WRVKNSQGVESPVPGVCFSLQPPDKEALDAVEKLRRQYERSVALWQRKQLRLRQNMIFAT
IKVVKDWSLQQFLDMGQDQRTAIRKALNEDAEKLLAEGDPSDPQLRRLRREMTEVNRLLD
DFEKRARAEEESRHAGRIFNEQITSLQQALEDAERILNIRIAAPLPRDRDSLEHLVLEHK
DYEQSLQRLAPKIEEVQQTFRGISLKTPQMKNKLDNVMSKWNHIWNLSNLYIERLKCVEI
VLSGLEENSNAISELEIKLASFGELPSDVKGLQNVLENLMVLQNAIAQQQIHVDQLNDDA
HTARRLVEKSRPNHRGPHGDMDRLDLEINRLNARWTNVCGQLVDRLRSAETAYGLAQQYQ
TSYQNEVDFVDESYGRLENLAPVHTKPQELETTKNLLNRVTDRAPAVEAVNLTGGRLIRE
GKIYGQKLRSFKEQLEELCPSLDASVKRPRRDSVASVDSIARDLDTLNRRYTTLVALLQE
RARKLAAIYPEDLTLQRALQEQRPLRTFRTEFNIYESSASEERYTSTITHFTESQTISRE
TSSPPTKANGGDGLPRSRSRNELDAPRARWPSSSKIGVAKEAQREESMEAENVINARGIL
HPLSKEMLTVGEAMSLGILDIRTGRIASSADSKSSLSIEEAARANLIDVDIASRLLGPCG
QTEAGQRLSLFEAIQRELLGAERTDDRVKQAVEEKYKLCDETLTKLLQWIADVEDKLAHQ
DVVNEDIEELRNQINCLKQVKEDIEAHSRPISTCLDQVRQVVLTGSDVLSNDEISSLEKN
GRSLKSRFERAVDRTDRLLKRLMGARDELNKFKSEISSFSIWLDKSRRLLEDKERSLSDL
KRLTSSTDTTRDFISDVIAHQADLRFITMAAQKFVDESKEYLQVLNEFRTSLPQRLSHKE
PISSQDSPVRSEVSIVTSQYKDLLSRANALSDRLSGLGGRQRDYCDALNKAQAWLRELEP
RLQRILSEPVAPEPKQVEDQLAKAKSLYSEVVANERLVDNARTSLQALLGSLEGQLTPSE
TNQLEEPVRELQERHHQLSQALADKCQELDTALVQCQGVQDALDNLVSWLNAAEAQFKNL
HRPASLQKDRLEEQQREQRLLQADLDSHRVSLEAVSSIAQELLLNSSNARVAKRTEAKLK
DLQSRFDKLMDKSLRRGEFLDEVARALHEFLTESAKFDSWYAKMIELLESRDLSKLDISE
YESKMAQLSDKREDQRGNYEDLVRNGKNLTAKKDVTDAASIRDKIKAIESQWKELSNLLD
EKQRLSKSRAERLSAYEKLRDQLIEWLNRTENRVQRLQPVAVDLERINQQIEELKPIQKE
YRDYGNTVDKLNDLGIAYDNLIRERSDSPTRRRTSSSPTKRPLRRMSHDGRSPSPNKSYA
VQSPVSPGGSSGFSSRRSSQDGFHLEELSPVQQQLSEINNRYGLLGVRLTDRQSELDNTR
EELRKYLDNLRTLSQFLDKIQRQLPKDVIPVTKDESDKTAKQIKIIIEEMYEKQSLLDST
KTQVRDLVRRKNGASGVDNLNKELEDVTHRWKTIGDKCKDRIKFLEDIKELYDTYEALHS
WLGAKERMLAALGPISSDPRMVASQVQQVQVLREEFRTQQPQLDHLKKVGKDVLARVPAD
SPDGQKISQKLNSILQRWEEQLKRLDDRAQSLGDAVDTSREFDASLNRLRDALQGISDNL
DDLPLDKDPEEQLRKIENLERQLEGQRPLLADAEAAGAQLCEVLSDPASKSDIQGKLASV
GKLYNNLQKKLDHRKAEIEGNLRDGRQFEASCSKTLGWLADELGNMSEKLLVSADREILQ
QQLDHHEPIYRNVMGKEHEVIMLLNKGRDILARSQKIENRTLQRDLDKMQLQWDRLKKDT
LDRHTKLQTCAEHCKKYYRAQNGFLPWLRQAEDRLESLKPASFKRKDIEKQLKELSSFRN
EVWKKSGEFENNNTLGETFVGACDIDKDVVKNELSAMKTRWDKLNNDLLERTQSLEDTAR
HLTDFNENLRDLNHGLQRCEDKLTSHDALGGAAKDPKLLDRIKSLREETVALKKPLAAVR
QQATDLVHKAGEQGVDATHLQDEVDGIVDRIDDLQAKLDDRCNELQSAATAVAQFTDILR
SLNQELSSLENELDSMKAPGRDIRTVREQIEKTRALLSKINRLSDDVGKLVNSGENLVDS
GFAADAVATRDQVDSLKRQLGKLEERARNREEELNDTLNKLQQFWHVHADVMDDINEVHE
QVKKFKPVGSEVDSIRMQQDDFRVLKANRIEPISRAVDECNSFGQALIQTAGRDVNTSSI
EKDLDKMNEKWNDLKERLNDRDRKLDVGLLQSGKFQEALDGLENWLADTEEMVSNQKPPS
SDYKVVKAQLQEQKFLRKMLMDRQNSMSSLSAMGQEVAAGADSKERKAIEKQLKNLIGRF
GNLSEGADERMKALERAMAVAKEFQDKLSPLSVWLDKSEKKIREMELVPTDEEKIQQRIA
EHNLLHKDILSKKPGFSELTDIASSLMALVGEEEANALADKLQEAADRYRALVERSEALG
ALLQRSKQGLRHLVLSYQELQAWMESMEARLSKHRVLAVHTERLLQQMEDLADLSEELSS
RQTEVDSTTESGLELMKHISGDEALQLKDKLDSLQRRYNELVTRGSELLKDAQTALPLVQ
QFHDNHSRLMDWMQAAEAVLQSAEPREEEIIRLEMEIAEYRPVLDKINAAGPQLCQLSPG
EGAASIEALVTRDNRRFDAIAEQIQRRAERIQLSKQRSLEVIGDIEDLLEWFREADGQLR
DAEPPSSEPEIIRVQLKEHRALNDDISSQKSRVRDVISTAKKVIRENGQHEDSSSIREKM
EELREIMETVAVLSGERLGALEQALPLAEHLRDSHLGLLGWLEEAEQQVAMLPMPALRPE
LIALQQDKTEMLIQNINEHKPLVDKLNKTGEALMRLCNEEEAGKVQEVLDNDNTRYAALR
AELRARQQALEQALQESSLFSDKLEGMLRALGNAAEQVRAAEPISAHPPRLRDQMEENAA
LAEDLAQREEAFAAVKKAASDVINKALTRGPSDPALNDIRRKLDKLNKLWAGVHKSTNDR
GQSLDETLAVAEKFWSELSGVMGALAELQDALSAQAPPAAQPKAIKQQQVALHEICQEID
QTKPDVEQVRQSGHELMGLCGEPDKPEVRKHIEDLDQAWDNVTALYARREENLIDAMEKA
MEFHNTLGDLHNFLEEAEVRFARMGPLGSDIHEVKQQIKDLARFKADVDPHMVKVEALNR
QAAELTERTSSEQAQAIKEPLGGVNRRWDALLRGVVERQRLLENALLRLGQFQHALDELL
VWIDKSDRTLDELRAVAGDPQVIEVELAKLKVLVNDIQAHQTSVDTLNDAGRQIIEDGKG
STEASTTAEKLGTLNRRWRDLLQRAADRQRELEDALRESQSFTAEIQDLLSWLGDVDNAI
VASKPVGGLPETASEQLERFMELYNELEQNRPKVETVLQQGKEYLKRAPDGSSSGLNHNL
RTLKQRWDNVIARASDKKIKLEIALKEATEFHDALQAFVDWLTNAEKTLTNLKPVSRVME
TILSQIEDHKAFQKDVGVHRETMLNLDKKGTHLKYFSQKQDVILIKNLLISVQHRWERVV
SKSAERTRALDHGYKEAREFHDSWSNLMNWLDDTEKALDEVAVDGLGGNDPDKIKFRLQK
HREIQLELSAKQGSYDTTMKNGKTLKDKAPKSDEPALRELLNELKSKWTTVCNKSIDRQR
KLEEALLYSGQFKDAVQALLDWLHKTEKVLSNTGPLHGDLDTVTSLVEQHRNFESDLESR
ALQMDSVTKTGRELESKATIEDATSIRQQLSELHTLWNTVTRLSNNKSSRLEEALRDAER
LHKAVHVLLEWLSDAEMKLRFAGQLPEDEQESRNQLMDHEKFLRELSSKEVEKDNTLELA
RTILAKAHPDGAVVIKHWITIIQSRWEEVATWAHQRNQRLETHMQGLQDLDNLLEELLAW
LEGLENTLIALEAEPLPDDRATLEMLISDHREFMENTARRQNEVDRVCKARQIKPIKDTR
KVFKSKPSTPIFKGSRDLSQSTRLLSRASPGRERTPDPSLPHIGPRFPPKGSSKGAEPEF
RNPRVKLLWDRWRNVWMLAWERQRRLQDKLNYIEELDRVANFSWEDWRKRFLKFMNHKKS
RLTDLFRKMDKNNDGLIPREDFIQGILNTKFDTSRLEMGAVADLFDRHGEGLIDWKEFIA
ALRPDWEERRTYNDTDKIHDEVKRLVMLCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILR
STVMVRVGGGWVALDEFLLKNDPCRAKGRTNIELREQFILADGVSQSMTAFRSKPSPTST
LQRNQLSSAGPITKVRERSARSVPMGQTRASRTSLSVGTPDSLSDNESSFRTPARKTSTP
YRSTLTPGGSRPSSRPASRPASRPGSRPASRQGSKPSSRYGSTQSLDSTDDPSTPSRIPR
RTGGTTGNTPTSSRHNSISGKRLTISTVNGSSSRPRTPTGLVSPASGTASSSMNRASSIP
TLTGVGTPIR
Download sequence
Identical sequences K7JAA9
7425.XP_001602426 gi|156552772|ref|XP_001602426.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]