SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7425.XP_001605642 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7425.XP_001605642
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 5.76e-32
Family Ribosomal L11/L12e N-terminal domain 0.0000148
Further Details:      
 
Domain Number 2 Region: 75-148
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 5.49e-18
Family Ribosomal protein L11, C-terminal domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7425.XP_001605642
Sequence length 165
Comment (Nasonia vitripennis)
Sequence
MPPKFDPTEVKKVFLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATSDWKGLKITV
QLTIQNRQATISVVPSAASLIIKALKEPPRDRKKVKNIKHSGNLSFDEIVSIARAMRPRS
MSRELSGTIKEILGTCQSVGCTVEGRPPHDIIDEINSGDFETPEE
Download sequence
Identical sequences A0A232F8S5 K7IZU1
XP_001605642.1.61660 gi|156549881|ref|XP_001605642.1| 7425.XP_001605642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]