SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7425.XP_001606812 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7425.XP_001606812
Domain Number 1 Region: 224-354,385-486
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.04e-68
Family Calponin-homology domain, CH-domain 0.0000344
Further Details:      
 
Domain Number 2 Region: 3294-3419
Classification Level Classification E-value
Superfamily Spectrin repeat 2.38e-22
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 3 Region: 3727-3874
Classification Level Classification E-value
Superfamily Spectrin repeat 2.95e-20
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 4 Region: 6666-6823
Classification Level Classification E-value
Superfamily Spectrin repeat 1.03e-19
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 5 Region: 1819-1947
Classification Level Classification E-value
Superfamily Spectrin repeat 9.29e-19
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 6 Region: 4367-4521
Classification Level Classification E-value
Superfamily Spectrin repeat 4.98e-18
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 7 Region: 5235-5390
Classification Level Classification E-value
Superfamily Spectrin repeat 2.74e-16
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 8 Region: 2783-2921
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000196
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 9 Region: 5663-5805
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000202
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 10 Region: 3085-3207
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000216
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 11 Region: 4156-4277
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000227
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 12 Region: 2873-3020
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000236
Family Spectrin repeat 0.0076
Further Details:      
 
Domain Number 13 Region: 5877-5993
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000115
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 14 Region: 4797-4919
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000012
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 15 Region: 5015-5155
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000513
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 16 Region: 6445-6598
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000106
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 17 Region: 6032-6148
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000236
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 18 Region: 1691-1816
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000458
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 19 Region: 6976-7092
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000047
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 20 Region: 1272-1409
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000525
Family Spectrin repeat 0.0081
Further Details:      
 
Domain Number 21 Region: 946-1065
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000017
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 22 Region: 3511-3664
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000236
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 23 Region: 2223-2343
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000264
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 24 Region: 3941-4064
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000324
Family Spectrin repeat 0.0078
Further Details:      
 
Domain Number 25 Region: 746-883
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000288
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 26 Region: 7566-7673
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000492
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 27 Region: 5464-5566
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000054
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 28 Region: 7190-7342
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000642
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 29 Region: 4518-4635
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000681
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 30 Region: 1080-1205
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000876
Family Spectrin repeat 0.0094
Further Details:      
 
Domain Number 31 Region: 1909-2060
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000131
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 32 Region: 5363-5459
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000374
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number 33 Region: 2700-2812
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000523
Family Spectrin repeat 0.0083
Further Details:      
 
Domain Number 34 Region: 7294-7449
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000482
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 35 Region: 4277-4381
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000306
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 36 Region: 1584-1704
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000335
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 37 Region: 886-968
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000523
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 38 Region: 1422-1530
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000276
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 39 Region: 7847-7954
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000372
Family Spectrin repeat 0.014
Further Details:      
 
Weak hits

Sequence:  7425.XP_001606812
Domain Number - Region: 4925-5012
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000124
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 6897-6990
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000424
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number - Region: 2350-2453
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000432
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 5581-5671
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000748
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number - Region: 3208-3284
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00173
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 4690-4788
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00187
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number - Region: 7725-7808
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0072
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number - Region: 564-684
Classification Level Classification E-value
Superfamily Spectrin repeat 0.012
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number - Region: 7087-7191
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0139
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number - Region: 2465-2588
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0144
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 6821-6890
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0522
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 3427-3517
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0528
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7425.XP_001606812
Sequence length 7958
Comment (Nasonia vitripennis)
Sequence
MSRNSGGGGGGGHAGTPSPRASTPRAGQQLRDRVSFFEQFSSSSAHQNRSSSSEDLVDEA
GLVVRRSSSRASNSSFEESFERLVEEGEYNGAKVVKFERITVKKSVREFSASALSASLSG
SNGTSRQGLTEASRTPSEEHIVGEDSAYQSHSHSHGMAGSKSSSVTSFAKFPSEESLAQR
RSLASSSSSPMEDKPPAEWYAEYRNQSFQQNAPSSKPEYMRSKSQFDAHIAEIKDEQERV
QKKTFVNWINSCLSKRVPPIRVDDLIEDLKDGTRLLALLEVLSGEKLPVERGRNLKRPHF
LSNVNTALQFLQSKKIKLVNINSSDLVDGRPPVVLGLIWTIILYFQIEENARALEYLSQT
WGSQSSLESIGTQGSAASERKRHSNEKWKQGARKTLLQWVTNALPKDLGIEVRDFGESWR
DGNAFLGIIDAIKSNVVSVPAMRQATNRVRLETAFNVAENELGIARLLDPEDVDVPQPDE
KCIMTYGTGSDSFAAVQQEYDLLLRWLNEKTRQLDQLDRNGGFPNSYEQYLMFKSEVDEK
SIIYHKLQNLVEAPSMISITRESWKHIQNLWKVLDMLMLRWLWLLDSSLPGELGDVGRWL
AHAESLLHSDDDIPEEMTEETASIISQKLEEHKKFFLDLPSIVEKFNRARSSPLARQVPS
QQLDNISSRLDSLPIRAAKRRIKLKFLEHKCCLVAFLYLVETRLKSWSIKYGNEEDVQNM
LENYRNFVSRNRIFQEFQKAYLDMQQVVEEYKKEGDIDREESLNVDRFIRETGEKWKNIS
MDLRCVQSMLEEVVTYWRRWSALSEEFENWLNRAEPVLSLPEEQKMEFFQDISVWKDKYQ
QISDTVSLLIATSEDQVALRLKDRYTNLSNRWERLFHEAKQYMHAGDLLRNWKDYREGVE
NLQTWLKNAEAALSTSQLTSTEKIKAFGDHLKVLHEEIEGIEELFKDVSKKFQTLIQDLS
REEVDKMMNTLKKEKEALVRVRALIPMQLHLYHQILVQQESLEAGQREISAWLDDAERLL
SSYNLSGGRDSALSQLERHKAFFSRTLYYKSMLESKNKVFNNIVKSVDAHKQPGDSEGSS
VLRHLNERFARVSQSAQLWEQRLQEAVRCWTKFRECERQISEWLSAAETLINDRNIDNRQ
SVEYHKNFFGKVNERWIQDLVNVAQDLRNALPVEQQAPIIEAVDSLQRRWKEVLTFAPLH
LMRLEFRLDEATFSQYLKEIEMEINAEQQAMVKNEEVGSILNRNKDFFVNRGMVVQVERS
LQTLKKISLAYSNLKPDDTSLSEAAQNAERRWEHTANRVEALREQLRQVPQQWAAYKQKF
GEMVCWMDHVDDTLRTMLHEVSSLEEFEQEKSVFQRVCHEADNKREEMKWLVQTLDSLTS
NRSDQEAVTEQRKLEQLITRYKNLIPTIEITMTKTDIYSKSYTYRKEVREVCTLLHKVRD
QTTEVPTLESLESLKKALKHQETCLNQLEQQRANIVSMLQRGKDLLRDQHAPNFVSSEVQ
QLEVSWNETYGQNIETLKTLKNSQKLWSNYDEQKEEILKLIAQAEEDLRRMDSAFYYNTA
QVSADLQHQQELSSSLRKTAINMVKKLHETYSSLIKVTTSEKQPELGKEVSQVEEMVHST
LEKVDERVEKLQVLQSKWNQFQSKIAELQNWTTQIAPQSIADIKASVTSPEERVTKTEIL
HKQIHEKVTILKIIEEESRILIKETDKKPEAQNLRTNIQNLHSAVDLLNENIVNQKERAS
QNLNTWKEYEVGIQQLKPWIEDAEAKATSIGSKPTTLRQANEMLETARVFEQQCAEHLPR
IHNLTQISQQLGSRTSAPDEVDTVHSRWNSIHDVALQTKTKLEKLVSSWNTFENDIKEFN
EWLRNTEKTVSMEPNLQTPDINKLEQELHRLKEFSKEISNRQAQLITLTQVSDQISHGLS
IEGASTLKNRVTELKARVSKLADTVRHHINSTSDAVLATNEFQIKISDFENWMSRLRQNM
AEISDVNIDNVDTSLQSVHAYLQEHSEKQPHFAAIYEEVKYLSSRGSPEEAANLDEIYTS
MAVKYKALEDDLLQKKRALEKWTELLNWNHETSAQLNHYKYEADARKPTIDDCERLSGEL
KNVQSKINSWKEQIPTIDSALGIQVRDNQEKPLTASSLINNLETQVVSLESTLNTKRDKL
ENLSSRWDKFRKLQQKLTEEIIGTQTALQEVTYTVDTCEKLGPAIEKITNLIEEHQQRCP
AKETLHQEGAELLKEDQRSMTNVQVVLSSVDSNWEKVNELLHEQRKKYTDMDSSWKQFVE
ARGKLTAFIDESINLCNSVKEVPNDITQATFAVEKHKKALETLKKGKPYLEKMDSKAQQI
MKEASLMPSFNVDSMESNVSSIHKKYQDTYSNIVEKIQLYETQVIIWKQIDDAKYELTRW
LSDTNESLTAACERLADAENGQSRLIKFREELPAHQLLRQGISTKTEQLLKFNRGVAIPT
LASLNHQLDEEFKRVHQSADKLDQMTSSFAEKENKIRQEIKQSSDSISKVREEIIKCDDL
TGENAKIMGRINRCKELKKELQRCNSVLKKVDEKLVELGTEYPSIMKSSLPKELQSLQTR
RDTVASHAEKVTATLCAFLMKLYHEKFSALQRLVATSREKITWCEPEHSSDKYNLEVKLA
SLLDVEADLQECEVRKRETDQSLKLLEKVENPDTLKTLRDERETIHVELESLKITFVNIK
KILEKNIVTWERYEMMSDSVLSWLKQAENRVRAETSVLLSPHEIENKIIEMTEFRSSFKQ
HKMEIGQLITFSKEIINVSPEARVEQYVHHLYARYEAVEKFISQQLNKLDEMQINRDEYE
KNAKQLDQWITKAEEKLKTYEEISGPKPMTFYQVRLKELKTFNDEREKGQAIFNATAESG
EALYSKINPDDRETIRADLRNLRSRLDNLTDRTNLVYKKVENDMMHRSSFEDKYSQIKQW
VIDAQAKLGNKQELLPTLQEKKLALHTYRTIAQDVNAHKSILQQLQERWGSLPDDESSSM
LNSVIESYDKLSENVEDRINVAEKHVANHEAYQQTFEKTRDWINTIVNETSALLDDLAIE
RETAKSSINLIENVLQQKEEGDRVIEDCNQQMNIVLEQTSIPGHQVLIKSFEEQKKIWQD
FLARCAVFREKLNRLFDEWSEFQRVVEELEAWTKHIEPQVKDQSLKSTEEAKIAHLQKLK
SLEEEIASKAPIFNSAIEKSQSIEAESELVTRVSKQATKYQALKNQARESVARYEQFVKE
HSTFNQRYNHFVQWIGELQTELKKHSEIVGDLNVLQQRQKVIRDLGDTRTKENPKFESVI
DLGEKLYTHTSPDGREIVRQQLRNLRQLWDSFSDDLQSATQKLDQCLMQFAEFSLSQEQL
TTWLRDVERAMHQHTELKSTLEEKRAQLQNHKIMHQEIMSHQTLVEAVCEKAQQLVDQTK
DTSLNIYLQSIKQLFHNIVSKSRDLLDNLEDCADKHNKFNIQCKAFSDWLQGEREKLLEC
NDCTGERTDISRRLATLSILKDGRNQGTELIKKLKDFAGIVAKNTAPKGQEAIHNEIANL
ESSLMQHISDIESVEAKQNAALKKWEEFEEPLESFMKWFRSMESAFRDQQLQPNLSEKQH
RLSALKEKREVILKKESEIDQFIDQSHVLLNTSGVERIKPLVSQISNRYTALLTLSKDVI
SRCEEIVDNHKAYDEKLSSTDAWLTPLEQHLATLKADEMKGSPEARTSRLQLLLTEKDQA
EHRLITLSTAGDKILPETSSQGREVVRQQIRRIRDRWDSLAEGIVEQQKKQGLQSLQWSS
YQETLQQILSWLDNMERSVKQESATVPSSLQEARSKLLKCKTVHQEIIAHKRIIEAVSEK
ANALIQVSQAPSDIEEKVKSVSKRYEKLVDTSSKGLVNLESILDVFQQFHDLQKAYKDYQ
KQQWDKLANYNDCTGNKVALQARLTKILEIQDNLGEGDVKLNALGEHVAKSSGMVSPRSQ
ESMDRDLNNLRFESKKFATAVGDAVRCIEERIQQWSEYENSLERLLVWLSDAETSLKNYS
LKNTIEDKQEQLEKYQALLVNLRQNEAEFDKMSDDSSDLIQISGESRFSVSVQQVTSRFQ
SIQVTAKELLKKCDQALSDHLSYLDKYKQCSERLAAAQQSYQATRDNISGTRQELSSHIE
TIHDLLARQSSMILLVNSTVEAGERLYTTTGNEGREIIRQQLLDLQQALETLYDNVTLTE
REIQAKISRWSGFDECSEAFEAWLKNAEAHLKSEIELKTTLDEKRAQLQIYRTFLHDAQT
HQQDLFNLRDKADSLPERPEKIEKVLNDLNRRHATVLKRAAGFVERYEGIVSDHQQYSKA
VLDTHEWLDATLNAVNMWGDAELDRVSLHTNLDRLQNLLQSLPEDEPRVYQIRSLGEKVI
PGTLESGQVNIRSQMDSSQQEWEGLVSAVKSTIDALEAKLQQWNEYEVSKERCLAWIRDT
DTKLHAVDLKSTLEEKKEQLEKLRSLQGEIRAKELEIDSVTERAHQLHKQTSRSSQISEL
GVKYQQISSKVKELNNKWQQYVTSHQEFDNQLSECTRWLDEIRNKLAYCSDLSASSQKDL
EKKMEIIQDLLLYKENGFAKIQGIVEVAQGVLANTAPAGHRAINDAVAKLQEQWSSLASK
MLETKTNLDDSINKWAGLLEQIQLINKTVEYMQTSVDELSQFQTTMSEKRSQLERIKALE
EKVRCENIEVDALKAKVGEMIASGQQSIAASQAQEILNKFDNLFERIKSLLTEREDQFKD
HRLYKEAHDDLIGWLSRAREKIPAVKQRSLSDKLAIENAVAPLESLLNKKAQGELMVEQL
QHTGQVVCASTSLQGQEVIRNEMRALTESFETLFQDIKQQKDQLETTVSQWRDYKDEYER
LSDWLQQFDILIKAQKNSLLPNVQEKEKQVKEVKEILANLEKGQEQIDKFNKSASALLAT
PLDTYVNNQLRHLNSRYQVQVNLAKDVLQKVETNFSQHQEYEMNLGKTRDWIENAKQIIR
QGTEAASSSSREELQQRLDKIQELLRKREEGQNLVHLTVNCGEKVMRNTRSDGREEIAAQ
LKEIQNDWERLVKKISTTKVHLETSLLQWADYSSSYSQLQQWINDREAKLQQVCEQKVSK
ARKGLAGLNSLAIGERKANLRQTNSIVQDIVAFEPMIQSVTTKAEDLQQATPATEISIKY
ETLSKQAKELYAKQKETVEQHQAFIDSGNEFVQWIRVAKERLGKCSEPTGDKESLASKIA
QLKVLQSELPEGQKKLEKALEQGNLACQIADDEDKEIIEEEVALLQEEYDNYVDSLNNTK
SLLEVAIVKWTEYEDQYSEAAEWLTQTEQLVQSFNKLQDCLEEKKNVLEQFQGHLQTLFD
WQKELDRLNMRAQMLLETCADTRISNAVTQLTTKYNAILSLAKEIMRRLELHYQEHQQHN
TLYQECQDWIDRTRDKLNECKEVPNTLPEVNNKLHTCKMIRQSLEQGQNKLRYALELKEK
VIMNTEQNGAAKIQEDTENLKADFDKLLIDVEEARQKLSARAGVLEELNKMHRLIADWLE
EVESNVHFDEVYRNDLSEKRALLEKYKTVQRDIHGHNENVEKLRLRLADDSNISKGPYDA
TIAKYEELRKLVAQKIQNLEKQVKDHEFYQQAFNDASDWVKRAKVDLQQYSITHGEKENV
IEREGKVKQMISTLPKGQSLISKVIETSQDVLLNTGPEGQDTINHDLDQLQADWNHLQSQ
CQEAETTLSNCILTWSQFTTALESMQKWIDQFQRKISAEHTKENKTPEDLTRCKNLVDEA
IRQKPILEDLNDKCELLMELSACNWAREKTVQLQSAYTALLTDAQSLVSRVEKNLSDHTE
FLKAKKEFEDWLHTAHGSIQDCVGVGDVAWAQDKLQTTKLVATRITEGQHLLSTLQAAFA
KAINTALPEQQDQLRTDMSELRSSWEQLSMDLNTIQAQVKSVLHRWEDFYETRDRFEEWL
NKTEESTKILPDTKGELGEMKTLLEKYKHVKDEVRNRKSDIDNLMSEATELSSWAKDNTT
LNQVKVLYARWESLDQQIDKQKTLIDDEMKEYNAYHAALQETEKWLLQVSFQLMAHNSRY
IVSKEQTLEQIKQHQALLDEIRNYETVLDDLKTKGHNQIERYEALNSSVKPTILTQLQNV
RDSYNSLLNTALQIENRLSESLAKFQEYENTLESIMKNLEAYEPEVAREQEAPLDTLESA
EDSLASAKTLYNKLQGEKARLVAAVEACEAAAACVSRPGSPLDAPSVQIPAKEMEVRNRL
DDLIDQRTEQSETDSSIRLKALLDGIEQNGCLDKLNDLCKKMQSHLSNVTKAVSELEEQT
RQKNALITWINQQRALCAEWKSRPAKLRAEAAQSELQAMNDLLTNVGDRRSRAEAEFLIR
PDGQDADIEEGLDKLEAELIDAIAGKQSAQDLIQKYRNEVHDIHSWFDALSKKVDVIEKG
NGLTIGQKIASLKEITSEFETQGPERLEDVRKLGDQVMDSVSNLDSQQIEEQIKSVERRH
GDISKKLQRKAQVLETTAQGIEATRREIEENREWISDKRRVARSSEPLGYESRQAEERLL
ALKGLLKEAEAKQVLTDSLEKRVGNMTNELEASEQQQLEQEVKALRVEQAELCSILREEI
SAATAAAETRRKLENDLEKARLWIKSTSNDLKKLSGYLPLKASKVEEDIAQHNTLTSEIR
RFSEGMLKELLKHGNAMLRECNDEDRDRLQALLDKVNDEYHDLQKEAHEKQAALADLLQG
RKAFESEMDKCQRWINEAEVATSSEIRTSSIDVLREQLAKYDRLKKEAKEYADDIEKIVQ
QGKSILPTISDADKLELSELLKNMKEAHSRVSGVINERAAALQKSIDEAEEVAARVAEAV
QFMTDIQQELQELNKPIGSRVEDVEGMLAAYERILNDLKANKAKLSDLQSVNVGDLHGVV
AQQDDLIRALEAQIAKLRQLLLLRQQFIALVTEIMTFIAKYTEIVRDIEQGGQTTEEKIK
KYEDVISKIQECEATLASATDKGQQIAAEGSTADRNNITEQLQSLKQQLQTLRRAVEHQR
EQHELAAAEHRRLANELADILDYLEGKEKEVKTRPLLDRHAESVETELKKHKDLCDGVNE
YLDKIRELKESVKHEDGMPGSLKEMFSEAMSLLSSLPREMEERENYLESNMQMRVDYAAL
TEKLRNWVHEAEIRLESDKEGLDFENILSDLEEHKIYFSSEASIRELVSQQIQQAADKIW
PSLSASEQEELSAEQQQHTQLLKNTLNTAKSQRARLEQGAEMWRDFAQTLERVKAVIART
RFTDEPVTTLAGLQFNIQKITHALNDIQNQQYELDLLNERGKEVLRQADASNKTKIEFQL
TEIGSEWRELVSGLEGRRDALEALSKHWEDLESKWSSTETKLNAIEERSKLVDTVVRSKQ
HLLDTIKTLDELTSEAETLKSDADEVRDLAGPVLSYLAAFTEPPARALEERIEKLSKAVD
TLVSLLRSKSEKSSEDLRSLRLVEEVIERHRERLESIGARIGQFHVHGADQAVIERELAD
LGAELDEELEALREFSGDTKARYQASQQLVPIDVAQKLAALELQAEDTSQAMEEKQREQK
RAKTTRTDYLADVDELQAWMREAELKVQDRSCEPSKMMENLRQIQTELAPMSDKLERLTK
NGKSIAENTRDEAEKEMVGSTVANLTEQLAQVKAWLEEKKQQVGDTLDAWQRFLALLEAV
KAWTAEKRVFLAEPLKLASLNQARQRLHEYSTAVKSCKQVNKNLSDMGRELEGIGQVTSV
GDLPLKLTEAEEAKVEVEGQLLERNALLQETSEEWEQCERKMKDVKVWMEKARQNLESPQ
NKKKPLRDQHAIREKMLSDVAIQKTKIAMSVEKLQVHFRSGIGGDSRVVEAADEILAELD
VLNETFKEQTASLEACLAQLDQYQQEIQQLRQQIVQVEQQLRTVLSPTYLPNDREKALQE
QQICRDRIKSLHSKIQARTERSKLLIQRGTPDIESLDP
Download sequence
Identical sequences K7IR53
gi|156543854|ref|XP_001606812.1| 7425.XP_001606812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]