SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7425.XP_001607090 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7425.XP_001607090
Domain Number 1 Region: 17-255
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.55e-76
Family Calponin-homology domain, CH-domain 0.0000689
Further Details:      
 
Domain Number 2 Region: 1101-1214
Classification Level Classification E-value
Superfamily E set domains 4.65e-37
Family Filamin repeat (rod domain) 0.0000214
Further Details:      
 
Domain Number 3 Region: 905-1014
Classification Level Classification E-value
Superfamily E set domains 5.42e-35
Family Filamin repeat (rod domain) 0.0000173
Further Details:      
 
Domain Number 4 Region: 741-853
Classification Level Classification E-value
Superfamily E set domains 4.01e-29
Family Filamin repeat (rod domain) 0.00052
Further Details:      
 
Domain Number 5 Region: 1291-1405
Classification Level Classification E-value
Superfamily E set domains 7.01e-29
Family Filamin repeat (rod domain) 0.00029
Further Details:      
 
Domain Number 6 Region: 448-564
Classification Level Classification E-value
Superfamily E set domains 1.13e-27
Family Filamin repeat (rod domain) 0.00054
Further Details:      
 
Domain Number 7 Region: 1988-2079
Classification Level Classification E-value
Superfamily E set domains 4.07e-26
Family Filamin repeat (rod domain) 0.0000257
Further Details:      
 
Domain Number 8 Region: 1792-1886
Classification Level Classification E-value
Superfamily E set domains 3.74e-25
Family Filamin repeat (rod domain) 0.0000602
Further Details:      
 
Domain Number 9 Region: 1614-1703
Classification Level Classification E-value
Superfamily E set domains 7.34e-25
Family Filamin repeat (rod domain) 0.0000487
Further Details:      
 
Domain Number 10 Region: 2177-2268
Classification Level Classification E-value
Superfamily E set domains 1.27e-24
Family Filamin repeat (rod domain) 0.0000967
Further Details:      
 
Domain Number 11 Region: 266-367
Classification Level Classification E-value
Superfamily E set domains 2.14e-24
Family Filamin repeat (rod domain) 0.00082
Further Details:      
 
Domain Number 12 Region: 1018-1120
Classification Level Classification E-value
Superfamily E set domains 2.66e-24
Family Filamin repeat (rod domain) 0.00021
Further Details:      
 
Domain Number 13 Region: 568-658
Classification Level Classification E-value
Superfamily E set domains 9.34e-24
Family Filamin repeat (rod domain) 0.00011
Further Details:      
 
Domain Number 14 Region: 370-480
Classification Level Classification E-value
Superfamily E set domains 1.13e-22
Family Filamin repeat (rod domain) 0.0014
Further Details:      
 
Domain Number 15 Region: 2304-2394
Classification Level Classification E-value
Superfamily E set domains 1.73e-22
Family Filamin repeat (rod domain) 0.000037
Further Details:      
 
Domain Number 16 Region: 659-754
Classification Level Classification E-value
Superfamily E set domains 5.08e-21
Family Filamin repeat (rod domain) 0.0012
Further Details:      
 
Domain Number 17 Region: 1907-2001
Classification Level Classification E-value
Superfamily E set domains 3.34e-19
Family Filamin repeat (rod domain) 0.00017
Further Details:      
 
Domain Number 18 Region: 2081-2173
Classification Level Classification E-value
Superfamily E set domains 7.34e-19
Family Filamin repeat (rod domain) 0.00016
Further Details:      
 
Domain Number 19 Region: 1216-1312
Classification Level Classification E-value
Superfamily E set domains 1.96e-18
Family Filamin repeat (rod domain) 0.0013
Further Details:      
 
Domain Number 20 Region: 1691-1790
Classification Level Classification E-value
Superfamily E set domains 3.07e-17
Family Filamin repeat (rod domain) 0.00011
Further Details:      
 
Domain Number 21 Region: 1547-1622
Classification Level Classification E-value
Superfamily E set domains 8.67e-17
Family Filamin repeat (rod domain) 0.00077
Further Details:      
 
Domain Number 22 Region: 1397-1502
Classification Level Classification E-value
Superfamily E set domains 9.34e-16
Family Filamin repeat (rod domain) 0.00077
Further Details:      
 
Domain Number 23 Region: 854-925
Classification Level Classification E-value
Superfamily E set domains 0.00000000000677
Family Filamin repeat (rod domain) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7425.XP_001607090
Sequence length 2394
Comment (Nasonia vitripennis)
Sequence
MNENDKSVKCESSQAEQEENEMVERELAEDAEWKRIQQNTFTRWANEHLKCANNHISDLE
SDLSDGLKLIGLIEVLAQKRLPKHNKKPTFRSQKLENVSVALKFLENQGIRIVNIDSTHI
VDCKLKLILGLIWTLILHYSISMPMWDGDDFGDDKGATPKQRLMNWIKSKIPELPINNFT
SDWNDGRAVGALVDAVAPGLCPDWQDWNPKDAAQNASEAMGLADDWLNIPQLIKPEEMVN
PNIDEMSMMTYLSQYPNAKLKPGAPIRPRTNPNRVRAYGPGIEPSGPIIGAPANFTVETF
SAGKGNVEVTVDDPKGLKLPVDIRFNKDRNLTYSVSYTPVNEGLHKVKVQFAGREIPKSP
FPVSVEGHAGDPSKVTASGPGLQPDGVVVNRPTFFDIFTKDAGRGVPEVIILDPQGQKTT
VPVKLRQTSPDVWRCEYVSPVIGLHSVNIFFAGKLIPNNPIGVRVAPVSDAKKCKAFGRG
LLANGVRVKDDADFVITTKDAGEGVADVKIIAPGGVNLPAKITKVSDDTYDCHYYPVKEG
RHVVMVTYGGKEIPKSPFEVNVAPYKESAIRVFGPGLLGGIVGHPARFTVDTNGETGALG
FSIEGPSKAKIDCVDNGDGTADVSYMPTAPGPYAVHILCDNEDIPKSPYIAQIVPKSDFD
PDKVEVHGPGVQPVGVVSDKPTNFTVDVKKAGQAPLEVAIQDAFGRDVPIKLEDKRDGTI
QAHYKPTSGSQHVVMVNYGGVATKKSPYRVKVEAPLNPALVQAFGPGLENAKTNTPTHFN
VNCREAGPGELKVDMKTPDNHDLPISLTDNEDGTYTVDYVAPDPGTYTVNLNYGGLKVPK
SPLKVNVQPRVDVSKVKVDGLRPADIQVAITAPSGGRCKAHVLPTHEGYLVNFTPTELGE
YLIGVSFGGEPIQGYPHRMTCLPTSEPWRVRASGPGLSTGIVDKPAEFVIDTRGAGQGGL
GVTVEGPCEAAINCRDNGDGTCSVAYLPTEPGDYVINITFNDQHIPGSPFQAMIDELPPL
DLSKIRLSGSGIQPHGLNVYQPTEFTIDTRAIGKPKGESENIGCHIKNPSGGVTEKIITP
QADGTYRVSYTPFEEGKHTIDILYDNIPVPGSPFSVNVKNVSDASKCRAYGPGLQKGIVN
KPNKFTVETKNAGTGGLGLAIEGPSEAVVSCKDNCDGTCSVEYLPTEPGDYDISIKFANQ
DIPGSPFKVQAEQPNDSNVVAYGPGLQPQMVREGVPATFTVDSTKTSNAMLDVKVKTDRG
SIGKPEIKRIRDGVHEVTYMPGQAGSTATVEVNYGGKPVQNSPFKVKVEPGCDPNKVVLS
GPGVSSITTASFPADFVIDTAKAGFGDLEVQVLGPDQSPRKVNIQNIGDGKYKATYLPDD
CGRYKVNVKYGGKDVPNSPVSVQSVSTGKADACKIKEGVQRTLAQGEEYCITVDTENAGR
GAVTCRIRSTSGSEDVDIDIQDNADGTVDVFYSVEDAGEYTLSIKFGGQPIPNGMYTFKV
SRRTNKHQEEHIVEQHTESSSTYTKRSTTSKQQFNVIRLNGIPVPSIGAGKIASEVKMPS
GNVDKPVVEDNRDGTVSIKYEPREEGTHEVYVKYNGEHVQGSPFKFHVDSLASGYVTAYG
PGLIYGVCGEPGNFTISTKGAGACGLSMAVEGPSKAEISCHDNKDGTVSVSYLPTAPGEY
KISVKFGDKHIKGSPYLAKITGEGRKRNQISVGSSSEVQLPGKVSDADIRSLNASITAPS
GLEEPCFLKKMPSGNICVSFTPREAGAHEVSVKRMGKHIANSPFKIDVKDREVGDAKKVK
VSGSALKEGKTQVDNTFSIDTRNAGYGGLSLSMEGPSKAEIQCKDNEDGTLNISYKPTEP
GYYIMNLKFADHHVEGSPFTVKVSGEGSNRQREKIQRRREAVPITEVGSQCKLTFKMPGI
TSFDLAATVTSPGGVTEDAEVKEIEDGLYAVAFMPKELGVHTVSVRYKDMHIPGSPFQFT
VGPLRDEGAHRVHAGGPGLERGEQGEPCEFNIWTREAGAGTLAVSVEGPSKAQIDFKDRK
DGSCYVSYVVSEPGEYRVGIKFNDQHIPDSPHKLYVAPAMGDAHKLEIAQFPEGSIQPDK
PYTFLVRKNGAKGELDGKIVSPSGIEDDCFIQSIDSEEYSVRFMPRENGIHNIHIKFNGV
HINGSPFRVKVGKVDADPAAIHAHGNGLKDIKTGQKTDFIIDTCNAGAGALGVTVDGPSK
VAMDCTEVEEGYKVRYTPLVPGDYYISIKYNGYHIVGSPFKVTATGADLAERGAQETSHI
TVETVQKFSKAKQAGPVLPHFKSDATKVTSKGMGLKKAYLGKQNQFTVNASEAGNNILFI
GMHGPKGPCEEVFLKHTGRNSYNVSYLVRERGEYILIVKWGDDHIPGSPFKVDV
Download sequence
Identical sequences K7IX85
gi|156548214|ref|XP_001607090.1| 7425.XP_001607090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]