SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7425.XP_001607596 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7425.XP_001607596
Domain Number 1 Region: 31-275
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.11e-87
Family Calponin-homology domain, CH-domain 0.00000191
Further Details:      
 
Domain Number 2 Region: 291-412
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-35
Family Spectrin repeat 0.0000716
Further Details:      
 
Domain Number 3 Region: 578-725
Classification Level Classification E-value
Superfamily Spectrin repeat 4.52e-32
Family Spectrin repeat 0.00018
Further Details:      
 
Domain Number 4 Region: 2148-2258
Classification Level Classification E-value
Superfamily PH domain-like 2.33e-30
Family Pleckstrin-homology domain (PH domain) 0.0000716
Further Details:      
 
Domain Number 5 Region: 1858-2013
Classification Level Classification E-value
Superfamily Spectrin repeat 3.57e-30
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 6 Region: 1646-1800
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-29
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 7 Region: 1221-1374
Classification Level Classification E-value
Superfamily Spectrin repeat 4.58e-27
Family Spectrin repeat 0.00043
Further Details:      
 
Domain Number 8 Region: 1433-1576
Classification Level Classification E-value
Superfamily Spectrin repeat 1.64e-26
Family Spectrin repeat 0.00038
Further Details:      
 
Domain Number 9 Region: 1539-1674
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-26
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 10 Region: 801-947
Classification Level Classification E-value
Superfamily Spectrin repeat 6.09e-26
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 11 Region: 1007-1132
Classification Level Classification E-value
Superfamily Spectrin repeat 1.23e-24
Family Spectrin repeat 0.00023
Further Details:      
 
Domain Number 12 Region: 376-521
Classification Level Classification E-value
Superfamily Spectrin repeat 1.09e-22
Family Spectrin repeat 0.0003
Further Details:      
 
Domain Number 13 Region: 1138-1254
Classification Level Classification E-value
Superfamily Spectrin repeat 4.71e-20
Family Spectrin repeat 0.00045
Further Details:      
 
Domain Number 14 Region: 1995-2079
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000301
Family Spectrin repeat 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7425.XP_001607596
Sequence length 2290
Comment (Nasonia vitripennis)
Sequence
MTTDISVQRTGWDPTLQQEIVDEYEYDGGNSSSRLFERSRIKALAGERELVQKKTFQKWV
NSHLVRCSSRIGDLYVDLRDGKMLIKLLEILSGERLPRPTKGKMRIHCLENVDKALQFLR
EQRVHLENMGSHDIVDGNPRLTLGLIWTIILRFQIQDITIEETDNQETKSAKDALLLWCQ
MKTAGYHNVNVRNFTTSWRDGLAFNAIIHKHRPDLIQFDKLSKSNAIYNLNNAFNVAEDK
LGLTKLLDAEDIFVDHPDEKSIITYVVTYYHYFSKMKQETVQGKRIGKVVGIAMENDRMI
REYESLTSDLLKWIESTITALGDRQFANSLLGVQSQLSQFSNYRTVEKPPKFVEKGNLEV
LLFTLQSKMRANNQKPYTPKEGKMISDINKAWERLEKAEHERELALREELIRQEKLDQLA
ARFNRKASMRETWLSENQRLVSQDNFGFDLAAVEAAAKKHEAIETDIFAYEERVQAVMAV
SQELETENYHDIERINARKDNVLRLWNYLLELLRARRSRLELSLQLQQNFQEMLYILDSM
EEIKMRLLTDDYGKHLMGVEDLLQKHSLVEADINVLGERVKAVVQQSQRFLEQDEGYRPC
DPTIIVERVQQLEDAYAELVRLAVERRARLEESRKLWQFYWDMADEENWIKEKEQIVSTG
DIGHDLTTVNLLLSKHKALENEIQSHEPQLMSVVSVGDELVRQQHFGSDRIQERLQEILT
MWNHLLDLAAFRRKRLEEAVDYHQLFADAEDIDVWMLDTRKLVSSEDVGRDEANVQSLLK
KHKDVSDELKNYASAVEQLHQQLGQLGEQDAKSPKVVERLAKIDESYKELQEMAKLRKQR
LLDALSLYKLFSEADGVEQWIGEKNRMLDTMVPAKDIEDVEIMKHRYDGFDKEMNANASR
VAVVNQLARQLLHVEHPNSKQIVQRQNELNQKWAELREKAESKREALNSAHGVQTFHIEC
RETVSWIEDKKRILQQTDSLEMDLTGVMTLQRRLSGMERDLAAIQAKLDALEKEAQLIEQ
DHPEEAAVIRERITQIHTIWEQLTQMLKERDAKLEEAGDLHRFLRDLDHFQAWLTKTQTD
VASEDEPISLADAEKLLTQHQNIKEEIDNYTDDYQKMMEYGEKLTSEAGDGDTQYMFLRE
RLNALKMGWEELHQMWANRQNLLSNSLNYQVFDRDARQAEVLLSQQEHILAKDETPTNFE
QAENMIKRHEAFMTTMDANDEKINSVEQFAARLVDDGHFAADKIKKKAESIYERRKANRE
KAQQLLDKLRDQQQLQLFLQDCEELSEWIQEKHIVAQDETYRSAKTVHSKWTRHQAFEAE
IASNKDRLQQLQAAADELLQQKPELSEIIQPKVSELADQFEELETTTHDKGKRLFDANRE
VLIHQTCDDIDSWMNELEKQIESTDTGSDLASVNILMQKQQMIETQMAVKARQVTELDKQ
AEHLQQTVPDDKMEEIKCKKEKVAQRFEQLKAPLNDRQRQLEKKKEAFQFRRDVEDEKLW
IAEKMPQATSKEFGNSLFNVHMLKKKNQSLRTEIDNHEPRINLVCNNGQKLIDEGHEDSE
EFNKLISELNEKWKELKDAVDERNAHLAQNEKAQQYFFDATEAESWMSEQELYMMVEDRG
KDEISAQNLMKKHEGLEHAVEDYAETIRQLGETSRQLISDQHPLADQIAVKQSQVDKLYA
GLKDLAGERRAKLEEALQLFILHREVDDLEQWIAERELVAGSHELGQDYDHVTLLWERFK
EFARDTEAIGSERVAAVNGIADSLIAAGHSDAATIAEWKDGLNEVWQDLLELIETRTQML
AASRELHKFFHDCKDVLGRILEKQNAMSDELGRDAGSVSALQRKHGNFIQDLSTLQSQVS
QIQEESAKLQASYAGDKAREITNREAEVVAAWNNLQSLCEARKTKLEDTGDLFRFFNMVR
TLMIWMDDVVRQMNTSEKPRDVSGVELLMNNHQSLKAEIDTREDNLLSCINLGKDLLARN
HYASSQIKEKLTALTDHRNALLHRWEERWENLQLILEVYQFARDAAVAEAWLIAQEPYLM
SQELGHTIDEVENLIKKHEAFEKSAAAQEERFSALQRLTTFELRELKRREQEREEEERRK
KEEAAAAEAARLAKATPVAKRTEKNDTDVRQGQSNDDEYEARSPSDDEFEGTLVRKHEWE
STTKKASNRSWDKVYMVVRGQTLVAYKDQKSCKSTPEQLYKGESPLDLKGATVIVASDYT
KKKHVFRVKTQSGADFLFQAKDDAEMNEWVSVLNQAAQGASVAGTSRAHTLPAPTQAETK
RRSFFTLKKK
Download sequence
Identical sequences K7INW9
7425.XP_001607596 gi|156538078|ref|XP_001607596.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]