SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7425.XP_001607603 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7425.XP_001607603
Domain Number 1 Region: 1066-1173
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.06e-32
Family Calponin-homology domain, CH-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7425.XP_001607603
Sequence length 1175
Comment (Nasonia vitripennis)
Sequence
MSEAQESAATTPRCDEPTEKKLFGGGGAVPDVHQRPAGQQQQQQQQKPVAAAPATRQQVG
ECNLLPVLVERLRSALELSCSSSSCDDQLPLEDSGVDSEEDFRLWNTAGLVAATGAAATT
GKPKLDLKFLEDILLADIHTALARLQDTLKRVDIGTLTRYNASLDPSNKLYLLRLISNLL
AKLKVPEEAIVQGDEPEHGAAHQGRFHNRRRKNERHTIGVSAEEIARAKRWFDEKSVSSN
DSSSPSRVEGIADKDLVVGSSSIERIVEGAPSATAVETPAIEDKLVVLQETAPTPMKPGT
FSDKCMKDAINQQQCKSNREQENSARYDPLERVLTAPRRFDGLCKDDSSIADGFQERSAA
SFYQQQQPHHSGPRHNKFTAKKSKIKRANTIDIPNYLKLKSDSPDQVQNGCFALRRPIDV
GDRLTNGHHQRVVPSFEPKTENDRKFLALINKNNSNAETATSQTANGSPFKSFNYRQAAT
VADKNWSNRFWNIKTNFDKPTRSEGEEELPRKPGKLDVRKKFENRDDSLEREAMLVGSLR
VMPQKQVNGFTHAPTSPFQKIEKPVAKQPETGPPFLKAAGYMPKNNNMLQAKLKMFDQEP
AKSNAETRAKSKFGKPPENKKPSAPSQPLENGQLNYYSFCKQFAPFASGRSNANEGKSNV
NSTKSKLLENIQKETDKPEPAKRDRPKVPTTQSSSQQHDFSKQYSYHKPYEGYAYQDYRQ
LEKKPQFNSPRGSFQAQEADFVKPEKPPRRFAEASTQNVAVQTTLESCTDRRPSAPELLV
SSSVEHPVPQPRKRNSVSVQTTSPSLLSPVNYNAQTSTSPSITSPIPHAHQAFKPANYSG
YHAPMPADQVPRNYYSNGSSYDYNAYPCKSNQHEVLSPKPTPAVPETPQLQGISQKLYNE
FSKLPDSNPAPRGPSFDYGKIDAPACDEAKILAFKPTVYPYEDPVGKPLPDVVEENIENQ
DISSDGIVTRYTCAIATISPDSPEPASDKAPRRRTSAATSTRSSVTTCSSSSSSKPMSPF
AKFRQLDRQNSAQITETFTPKFSTPKTPGKEFQFKFTDPTVQNNAALIKERLLSWCRAKT
KEYENVQLDNFSTSWSNGLGFCALIHHFRPDAFDYHSLRSEDRRKNFELAFTKADEVAGI
APLLDVEDMVMMRRPDWKCVFTYVQSIYRRFKDED
Download sequence
Identical sequences K7IRZ0
7425.XP_001607603 gi|156544432|ref|XP_001607603.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]