SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7425.XP_001607748 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7425.XP_001607748
Domain Number 1 Region: 10-167
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.31e-46
Family Calponin-homology domain, CH-domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7425.XP_001607748
Sequence length 184
Comment (Nasonia vitripennis)
Sequence
MALERQVHAKILAKRDPEQEREAQEWIESIIGNKFPAGLPIEDVLKDGVVLCELMNKIKP
GSINKVNTSGGEFKMMENINKFQKALKEYGVSDVDVFQTVDLWEKKNIAQVVTTLFALGR
ETYRHPEFQGPNLGPKPADECKRDFSEEQLKAGQTVIGLQAGSNKGATQAGQNMGASRKI
LLGK
Download sequence
Identical sequences K7J2Y6
gi|156551940|ref|XP_001607748.1| 7425.XP_001607748 XP_001607748.1.61660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]