SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7460.Q1W639 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7460.Q1W639
Domain Number 1 Region: 20-126
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 6.54e-22
Family Insect pheromone/odorant-binding proteins 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7460.Q1W639
Sequence length 135
Comment (Apis mellifera)
Sequence
MKTILIISAICICVGALSIKDFQNAIRMGQSICMAKTGINKQIINDVNDGKINIEDENVQ
LYIECAMKKFSFVDKDGNFNEHVSREIAKIFLNENEINQLITECSAISDTNVHLKITKIF
QCITKFKTINDILNS
Download sequence
Identical sequences Q1W639
7460.Q1W639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]