SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7460.XP_001122261 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7460.XP_001122261
Domain Number 1 Region: 12-77
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000118
Family Calponin-homology domain, CH-domain 0.01
Further Details:      
 
Weak hits

Sequence:  7460.XP_001122261
Domain Number - Region: 149-243
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.0405
Family PspA lactotransferrin-binding region 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7460.XP_001122261
Sequence length 264
Comment (Apis mellifera)
Sequence
MATEEDKKNDKNQIEELYAWISTIPLSKPTKNLSRDLSDAVIIAEILKIYYPRYVDLHNY
VPANSITMKKENWKILNRKVLSKIHMKLNKNIINQLANCHPGTAEYVLLELKKKVLKDFE
NLSFKENDFIEEEKVDTDETKATISSKSLPNVVDQLTLELKEDAETQRTSEDINGEDGVP
RHVCVQLRQKLQEIDDIIYTLNHKVAYLESTMKLKDMRISNLTSQILLHNEESKSQFTKV
EMNHDTSSKIRVQNIEERGVKIEK
Download sequence
Identical sequences 7460.XP_001122261 XP_016768439.1.77095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]