SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7460.XP_392230 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7460.XP_392230
Domain Number 1 Region: 118-610
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.16e-166
Family Calponin-homology domain, CH-domain 0.00000000321
Further Details:      
 
Domain Number 2 Region: 7-85,407-440
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000307
Family Penta-EF-hand proteins 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7460.XP_392230
Sequence length 631
Comment (Apis mellifera)
Sequence
MATAIDDRQELLEQFQAIDENGDGFINLTELRSALDICGFKMPGYKVRQMIEEYDDKQRS
EHKGRLSFEEFEKLCKELKANELGSTFKQVVSKKENLETLGGISEASSEGTTHSVRLEEQ
LAFSDWINTNLSHDPDLKHLLPIDPEGKTLYEKVKDGILLCKIINHSCPDTIDERTINKK
NLTLYKKHENLTLALSSAQAIGCNIVNIDAHDLTKGSPHLVLGLLWQIIRIGLFNQITLE
NCPGLATLLQDGERIEDLLKLSPESILLRWVNHHLENAGIVRRCHNFQSDITDSEIYTYL
IKQIAPNTAGVTLEAMMEPNHTSRAEIMLQQAAKLGCRSFVTPSDVVNGIYKLNLAFVAN
MFNNYPGLDKPENNIGLESLEETREEKTYRNWMNSMGVVPHVNWLYSDLADGLVIFQLYD
IIKPGTVNWNRVHKKFTKLRKFMEKLENCNYAVELGKTMNFSLVGIAGQDINDGNATLTL
ALIWQLMRSYTLSILTSLAGTQGSSLVEKEIVQWVNSKLQGAGKASGIKGFQDSSIADGK
VVIDLIDAIKPGSVNYDLVKEGGTEEENLDNAKYAISLARKCGARVYALPEDITEVKPKM
VMTVFACLMAMDYIPNMDSMKQNNVQMNNSQ
Download sequence
Identical sequences A0A088ALH6
7460.XP_392230 XP_392230.1.77095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]