SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7460.XP_393655 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7460.XP_393655
Domain Number 1 Region: 30-253
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.46e-67
Family Calponin-homology domain, CH-domain 0.00013
Further Details:      
 
Domain Number 2 Region: 2668-2781
Classification Level Classification E-value
Superfamily E set domains 2.07e-27
Family Filamin repeat (rod domain) 0.00082
Further Details:      
 
Domain Number 3 Region: 2771-2878
Classification Level Classification E-value
Superfamily E set domains 6.67e-26
Family Filamin repeat (rod domain) 0.00071
Further Details:      
 
Domain Number 4 Region: 2569-2687
Classification Level Classification E-value
Superfamily E set domains 1.79e-21
Family Filamin repeat (rod domain) 0.0016
Further Details:      
 
Domain Number 5 Region: 1509-1607
Classification Level Classification E-value
Superfamily E set domains 2.07e-20
Family Filamin repeat (rod domain) 0.0042
Further Details:      
 
Domain Number 6 Region: 2210-2314
Classification Level Classification E-value
Superfamily E set domains 1.07e-19
Family Filamin repeat (rod domain) 0.0035
Further Details:      
 
Domain Number 7 Region: 1953-2045
Classification Level Classification E-value
Superfamily E set domains 1.47e-19
Family Filamin repeat (rod domain) 0.0022
Further Details:      
 
Domain Number 8 Region: 2313-2406
Classification Level Classification E-value
Superfamily E set domains 2.27e-19
Family Filamin repeat (rod domain) 0.0033
Further Details:      
 
Domain Number 9 Region: 1692-1778
Classification Level Classification E-value
Superfamily E set domains 4.34e-19
Family Filamin repeat (rod domain) 0.0041
Further Details:      
 
Domain Number 10 Region: 1608-1687
Classification Level Classification E-value
Superfamily E set domains 2e-18
Family Filamin repeat (rod domain) 0.003
Further Details:      
 
Domain Number 11 Region: 1776-1868
Classification Level Classification E-value
Superfamily E set domains 5.27e-18
Family Filamin repeat (rod domain) 0.0032
Further Details:      
 
Domain Number 12 Region: 1419-1508
Classification Level Classification E-value
Superfamily E set domains 6.34e-18
Family Filamin repeat (rod domain) 0.0029
Further Details:      
 
Domain Number 13 Region: 264-354
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.03e-16
Family Calponin-homology domain, CH-domain 0.0031
Further Details:      
 
Domain Number 14 Region: 1868-1958
Classification Level Classification E-value
Superfamily E set domains 1.73e-16
Family Filamin repeat (rod domain) 0.0071
Further Details:      
 
Domain Number 15 Region: 1251-1330
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000018
Family Filamin repeat (rod domain) 0.0051
Further Details:      
 
Domain Number 16 Region: 456-547
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000036
Family Filamin repeat (rod domain) 0.0028
Further Details:      
 
Domain Number 17 Region: 1059-1147
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000394
Family Filamin repeat (rod domain) 0.0026
Further Details:      
 
Domain Number 18 Region: 973-1061
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000734
Family Filamin repeat (rod domain) 0.0048
Further Details:      
 
Domain Number 19 Region: 552-634
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000867
Family Filamin repeat (rod domain) 0.0056
Further Details:      
 
Domain Number 20 Region: 2138-2233
Classification Level Classification E-value
Superfamily E set domains 0.000000000000018
Family Filamin repeat (rod domain) 0.006
Further Details:      
 
Domain Number 21 Region: 1328-1419
Classification Level Classification E-value
Superfamily E set domains 0.000000000000347
Family Filamin repeat (rod domain) 0.0042
Further Details:      
 
Domain Number 22 Region: 2408-2495
Classification Level Classification E-value
Superfamily E set domains 0.000000000000867
Family Filamin repeat (rod domain) 0.0044
Further Details:      
 
Domain Number 23 Region: 1150-1241
Classification Level Classification E-value
Superfamily E set domains 0.00000000000133
Family Filamin repeat (rod domain) 0.0078
Further Details:      
 
Domain Number 24 Region: 364-455
Classification Level Classification E-value
Superfamily E set domains 0.000000000107
Family Filamin repeat (rod domain) 0.005
Further Details:      
 
Weak hits

Sequence:  7460.XP_393655
Domain Number - Region: 2050-2117
Classification Level Classification E-value
Superfamily E set domains 0.000127
Family Filamin repeat (rod domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7460.XP_393655
Sequence length 2903
Comment (Apis mellifera)
Sequence
MESTEQLRPEELVGLVARSAEGTAAKGMPIKGHEDLWVEIQANTFRNWVNEHLKHAVDTA
NSPVIDLVEDFRDGTRLCALVEVLTKRRLPRWNPRPANQHHHLENVSTALQAIEADGVKL
VNIGNVDIVNGNLKLILGLIWSLIVRYQIGKSKFPPRKLMLAWLKTVLPECRVNNFTTDW
NSGVYLSALLDYCQPGLFPHWRRLDPNDSVYNCRKAMEISKREFDIPMVLEPEYLASPYM
DELSGMTYLSYFMKEGSPGFHATLRWVNSQLSHPVQNFTTDWNDGRTLCSIVRNLGGSAP
AYDKIDVDPSMWEHNIQMGIDGGKKLGVEPILKAKDMADQNVEHLGVMAYAACFQWVKPR
PQTSKQIVVHIDSTSARVQQPAHFKLEILTKEVNTREVRGEVISPSGRIECRLTWNGVHG
KGTFIPVEVGMHKLMVYNDGELVDGCPYYFRVLPPLTKIKSPGMDPCAIGSIVEVLVNSY
GTSHDGIDVTAWSPTGRSLLCPVKENDGVHTATFQPDETGEWSIAITHKGNHIQGGPFTC
FVFDPNGIKLLDTEGALPGQPFSFTVDATGTGGLGDVIIDLVHDKQSIPFRMENSRHMQY
RVSFVPSESGKYRVYIYFNGSDVRGSPFSIRVGTQKGSKRSKESSFDKTKLSSLERRMND
LNVSMETDRSSPLLKQKSYSPTTYKLSSPTQHIREYSPVHQTTSAYKTSNYLENSSSTYH
TSTSINHTRSPSHSNSPISRNLHSPSMIKDTKEIYSTTYNHSRSPTAQSPNFMKESKDIY
TSNTTSTSRSPNPSPIHGSRYSPVIKESREIYSSGSLKRSRSPDRMAYRSATQSPVNRSF
SPRNNDRDNSYNRKDFTDNGTVDTSSNVRVSSMVGGTSRRDSWDAIEKTKSLLSYGSLES
LANLTNNSAMKVSTSEYNISQKYNNENHNIRTQTHGILKNKNNNYYKNVDITDGVHERYF
NNVISSSSTQDRNYEFVTGSALETLPIHRPATFTIDQNIDASKVTVNVCGPSGKIIPIQK
STLRGLTYSITAQEVGEHIIQILVNGQHIQGSPFRSQAYNAHAIQVGNIPNGVVNQPVEF
EIDGSNAGSGNLEILVNGGHVTSFVRALGSQRFLASFVPHEAVVHLVEMTFNGEVVPGSP
WRVGIMPVPKMSVIGDSIRLVPAGSPAFFELSALGFNSNEIDVQIITPSKRYIQAKIDEV
SGRSGEFRVEFTPIEVGSHLVEVTIAGQKLPAGPLVAKVYNSSLIQVTDVPSAVVGHACQ
FRVDASAAGEGQLEISINEGEVPNHVQVVGGGRCLVSFTPETAKSHYIDIKFNGEAVKGC
PFICNVSDTSRVTLSLNHLELIPVDQPASFHMGVDGSGNAELAVSVKGPNCELPVKVTGD
IKNGFTAEFIPRDVGVHSISVEYNGHAVNGTPFLAKAFNADKVLIGPVARGSVGQPTHFT
VDASQAGEGNLEITISARNQNIPTQVTPQGNARFSVSFVPFEACEHIINIAFNKRTVPGC
PIITRVGGDSHVTVSGQALSSAGLGRQSYLTISNVAGSLEDLEVNVEGPNGQAVPAQVTD
NKDTTCSVAFTPRVVGEHRISVSHRNVPVIGSPFSCKVYDVTAIKVKDAKHGVIGMPVTF
LVETSQAGPGNLEVTVNGGRVPTSAQAQGPHTYAISFTPREPIVHTVDLRFNGEDVPGSP
FSCQVSDTAKVIITEGLEKVSVNRLTTFTIEADISLGTPIVEVLSPTRESLPIHVKQSGH
GCYTAGFTPKDVGDHSVEVKINGLHVEGSPFLVKAYNADKVKVTDINSGIVGKPVFFSIN
ASQAGAGNLEIIVAVNGKNVPNYVQSEGXAKFRVNFKPQEAAVHSLSVRFNGEPVPGSPF
SCKVVGAGQAIIIGHNLKMGAVKQLMSFIVDPQALSTNCDVIVTPPSNISLPITIEPVDG
KYNISFVPVEVGRHNISILVDSEHVKGSPFACNIYDVTKVHVSGLTEALLGQATTFTVDA
AEAGEGTLELVVSTENNTVKAEVVACARGLYDVTFVPQTTSTHYVNISFNDDNVPGSPFK
CPIISTMLDGPSMIRVGNTAYMDLEMPGLEGPVSAEVTGPDSIIIPCTLMKLSPNLYRVE
IRTRQVGTYSVIFSDGHKMISSQTLQAFDSGKVTIKEISDVVCHRPGTITVVVSKEAGPG
KLTVNVRAAGADVDSVIREGENGQYDIIFHPTRAAPHKVHIKYNEVHILGSPLDLTVRGP
TGGREVTATGLGLYQSCVNKVTSFTIETLGSPGKEFDVVISGPQGNAVPVRCYQHRDGNL
LAEFTTSTVGTYKIDVLQGTKPVLGSPFFCQAFDVSKVKLQELGPMTVSVHDHIVFKIIK
TDAGMADLDVVATSPLGQELPLQVTPLNDGAEMVEFSPSVPGTYMINITYGGYPIPDSPL
VCTVDAAGQARAKGEGLLSGHVDKTAHFIVTGTRSPPAVQVDGPDSVSKAVIEAGANPGT
WNVSYIPTEAGVFDIRIVSAGQQLPGSPWHPKIIDTRNLRVIGGWPAVCDDVGRLKIHPS
NKISFDTAEAGPGELTGKIGDHTLSFEMTSNNRLKLIPPKLNGGEYRLEIFFNGISFPGA
PKLVIVQDLETPIQDTSRVLLRGRGLTSAKCGEEVSFTIDGSQAGTGTPKVQLFSPTSEL
NVMLQHLGDSVYRASYIPLTPDPLLMTVSWNGRQLKGCPLQINVTNAADASRVICSGDGL
KHGIVGQEIRSFIDTRRAGPGELTAHCVGPHKVAYCELYDHGDATFTLNVKPQEAGRHAL
TIKYAGEHVPGSPFTLRVSGAPDASKVRVYGPGIEHGVLATFQSRFICDTRGAGAGQLTV
RVRGPKGAFRVEMQRETQKDRIILCRYDPTEPGDYRVEVRWAGVLVPGSPFPVKIVDTQD
ELLMLTQNGDNYSTGHHTIASWQ
Download sequence
Identical sequences 7460.XP_393655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]